IMUP Recombinant monoclonal antibody, PBS Only (Capture)

IMUP Uni-rAb® Recombinant Antibody for Cytometric bead array, Indirect ELISA
Cat No. 84148-4-PBS
Clone No.241220D10

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

Cytometric bead array, Indirect ELISA

C19orf33, H2RSP, HAI-2-related small protein, Hepatocyte growth factor activator inhibitor type 2-related small protein, Immortalization up-regulated protein

Formulation:  PBS Only
PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

84148-4-PBS targets IMUP as part of a matched antibody pair:

MP01103-2: 84148-4-PBS capture and 84148-3-PBS detection (validated in Cytometric bead array)

MP01103-3: 84148-4-PBS capture and 84148-1-PBS detection (validated in Cytometric bead array)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity human
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag22218

Product name: Recombinant human C19orf33 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-85 aa of BC060319

Sequence: MEFDLGAALEPTSQKPGVGAGHGGDPKLSPHKVQGRSEAGAGPGPKASNFRGLGKGRRLTAAPPSSKDTTALPTPAAAPAIRTRM

Predict reactive species
Full Name chromosome 19 open reading frame 33
Calculated Molecular Weight 106 aa, 11 kDa
GenBank Accession NumberBC060319
Gene Symbol IMUP
Gene ID (NCBI) 64073
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ9GZP8
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.
Loading...
||
New chat Able
正在加载,请稍候...