C19orf57 Polyclonal antibody

• 

  WB analysis using 25050-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 25050-1-AP (C19orf57 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of Jurkat using 25050-1-AP

  WB result of C19orf57 antibody (25050-1-AP; 1:2000; incubated at room temperature for 1.5 hours) with sh-Control and sh-C19orf57 transfected Jurkat cells.

• 

  WB analysis of PC-3 using 25050-1-AP

  PC-3 cells were subjected to SDS PAGE followed by western blot with 25050-1-AP (C19orf57 Antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of A2780 using 25050-1-AP

  A2780 cells were subjected to SDS PAGE followed by western blot with 25050-1-AP (C19orf57 Antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of A431 using 25050-1-AP

  A431 cells were subjected to SDS PAGE followed by western blot with 25050-1-AP (C19orf57 Antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of K-562 using 25050-1-AP

  K-562 cells were subjected to SDS PAGE followed by western blot with 25050-1-AP (C19orf57 Antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of mouse testis using 25050-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse testis tissue slide using 25050-1-AP (C19orf57 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of A431 using 25050-1-AP

  Immunofluorescent analysis of (4% PFA) fixed A431 cells using C19orf57 antibody (25050-1-AP) at dilution of 1:600 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L) (SA00013-2), CL594-phalloidin (red).

• Featured Product
• KD/KO Validated

C19orf57 Polyclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 25050-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, IF/ICC, ELISA

Synonyms

Pre-T/NK cell-associated protein 3B3, BRME1, Break repair meiotic recombinase recruitment factor 1

---

Tested Applications

• Positive WB detected in: Jurkat cells, K-562 cells, PC-3 cells, A431 cells, A2780 cells, MOLT-4 cells, mouse testis tissue
• Positive IHC detected in: mouse testis tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: A431 cells

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:6000
• Immunohistochemistry (IHC): IHC : 1:50-1:500
• Immunofluorescence (IF)/ICC: IF/ICC : 1:300-1:1200

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

25050-1-AP targets C19orf57 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag21745

  Product name: Recombinant human C19orf57 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 281-637 aa of BC119719

  Sequence: ASAPTSGPAPGLGPASWCLEPGSVAQGSPDPQQTPSRMGREGEGTHSSLGCSSLGMVVIADLSTDPTELEERALEVAGPDGQASAISPASPRRKAADGGHRRALPGCTSLTGETTGESGEAGQDGKPPGDVLVGPTASLALAPGSGESMMGAGDSGHASPDTGPCVNQKQEPGPAQEEAELGGQNLERDLEGFRVSPQASVVLEHREIADEPLQEPGAQQGIPDTTSELAGQRDHLPHSADQGTWADSLAVELDFLLDSQIQDALDASDFEAPPEQLFPSGNKPGPCWPGPSSHANGDPVAVAKAQPSRLIMGTHRDLEAFKRLNYRKTKLGGKAPLPYPSKGPGNIPRGDPPWREL

• Full Name: chromosome 19 open reading frame 57
• Calculated Molecular Weight: 668 aa, 70 kDa
• Observed Molecular Weight: 60-100 kDa
• GenBank Accession Number: BC119719
• Gene Symbol: C19orf57
• Gene ID (NCBI): 79173
• RRID: AB_2879871
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q0VDD7
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.