C19orf62 Polyclonal antibody

• 

  WB analysis using 27926-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 27926-1-AP (C19orf62 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HepG2 using 27926-1-AP

  HepG2 cells were subjected to SDS PAGE followed by western blot with 27926-1-AP (C19orf62 antibody) at dilution of 1:4000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human breast cancer using 27926-1-AP

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 27926-1-AP (C19orf62 antibody) at dilution of 1:500 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human breast cancer using 27926-1-AP

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 27926-1-AP (C19orf62 antibody) at dilution of 1:500 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

C19orf62 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 27926-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

Human

Applications

WB, IHC, ELISA

Synonyms

BABAM1, C19orf62, HSPC142, MERIT40, NBA1

---

Tested Applications

• Positive WB detected in: HeLa cells, HepG2 cells, U-251 cells
• Positive IHC detected in: human breast cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:5000
• Immunohistochemistry (IHC): IHC : 1:250-1:1000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

27926-1-AP targets C19orf62 in WB, IHC, ELISA applications and shows reactivity with Human samples.

• Tested Reactivity: Human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag27459

  Product name: Recombinant human C19orf62 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 7-143 aa of BC000788

  Sequence: SSPTEEEEEEEEHSAEPRPRTRSNPEGAEDRAVGAQASVGSRSEGEGEAASADDGSLNTSGAGPKSWQVPPPAPEVQIRTPRVNCPEKVIICLDLSEEMSLPKLESFNGSKTNALNVSQKMIEMFVRTKHKIDKSHE

• Full Name: chromosome 19 open reading frame 62
• Calculated Molecular Weight: 329 aa, 37 kDa
• Observed Molecular Weight: 37 kDa
• GenBank Accession Number: BC000788
• Gene Symbol: C19orf62
• Gene ID (NCBI): 29086
• RRID: AB_2881010
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9NWV8
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.