Use Able AI chat for product recommendations

C19orf63 Polyclonal antibody

C19orf63 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 30844-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, ELISA

EMC10, ER Membrane Protein Complex Subunit 10, Hematopoietic signal peptide-containing membrane domain-containing protein 1, HSM1, HSS1

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inHeLa cells, U2OS cells, MG-63 cells
Positive IHC detected inhuman liver tissue, mouse kidney tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:1000-1:6000
Immunohistochemistry (IHC)IHC : 1:200-1:800
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

30844-1-AP targets C19orf63 in WB, IHC, ELISA applications and shows reactivity with human, mouse samples.

Tested Reactivity human, mouse
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag34064

Product name: Recombinant human C19orf63 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-227 aa of BC035001

Sequence: MAAASAGATRLLLLLLMAVAAPSRARGSGCRAGTGARGAGAEGREGEACGTVGLLLEHSFEIDDSANFRKRGSLLWNQQDGTLSLSQRQLSEEERGRLRDVAALNGLYRVRIPRRPGALDGLEAGGYVSSFVPACSLVESHLSDQLTLHVDVAGNVVGVSVVTHPGGCRGHEVEDVDLELFNTSVQLQPPTTAPGPETAAFIERLEMEQAQKAKNPQEQKSFFAKYW

Predict reactive species
Full Name chromosome 19 open reading frame 63
Observed Molecular Weight28 kDa
GenBank Accession NumberBC035001
Gene Symbol C19orf63
Gene ID (NCBI) 284361
RRIDAB_3742375
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity Purification
UNIPROT IDQ5UCC4
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

EMC10 (Endoplasmic Reticulum Membrane Protein Complex Subunit 10) is one of the key components of the highly conserved endoplasmic reticulum membrane protein complex (EMC). The core function of this complex is to act as an insertase and chaperone in the endoplasmic reticulum, assisting in the correct folding, assembly, and membrane integration of membrane proteins, and preventing the aggregation of misfolded proteins. Studies have shown that EMC10 plays a dual role in cells: within the cell, it ensures the biogenesis of important membrane proteins such as G protein-coupled receptors (GPCRs); moreover, it can be secreted outside the cell (referred to as sEMC10), where it acts as a novel signaling molecule to activate the hypothalamic-pituitary axis, regulating energy metabolism and body weight in the body, and is closely related to obesity and metabolic diseases.

Protocols

Product Specific Protocols
IHC protocol for C19orf63 antibody 30844-1-APDownload protocol
WB protocol for C19orf63 antibody 30844-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat

Able

正在加载,请稍候...