Tested Applications
| Positive IHC detected in | human prostate cancer tissue, mouse pancreas tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | A549 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:200-1:800 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
24856-1-AP targets C19orf73 in IHC, IF/ICC, ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag21567 Product name: Recombinant human C19orf73 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-129 aa of BC069712 Sequence: MRLKVGFQGGGCFRKDALCLEGGVSARWARAPHSAPLRPPRELHAAPPPATPTQTVVRPAGFPRRTRLMVRSAPPTQRPPTGSGCVSGLWRKGLGLRPQTLLRVGGVVLSSAPALRPRLGPCLRPPPSD Predict reactive species |
| Full Name | chromosome 19 open reading frame 73 |
| Calculated Molecular Weight | 129 aa, 14 kDa |
| Observed Molecular Weight | 14 kDa |
| GenBank Accession Number | BC069712 |
| Gene Symbol | C19orf73 |
| Gene ID (NCBI) | 55150 |
| RRID | AB_3742127 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q9NVV2 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
C19orf73, now officially named Autophagy-related protein 13, is a core regulatory factor in the initiation of cellular autophagy. As a key component of the ULK1/ATG1 complex, this protein plays a critical role in responding to signals such as nutrient deprivation and energy stress. When the mTORC1 pathway is inhibited, ATG13 forms a stable activation complex with proteins including ULK1 and FIP200, initiating autophagosome formation. Dysfunction of ATG13 is closely associated with various diseases: in neurodegenerative disorders, impaired autophagy leads to abnormal protein aggregation; in tumor development, autophagy exerts dual regulatory effects on cancer progression. The expression level and activity of ATG13 are finely regulated by phosphorylation modifications, making it a crucial molecular switch connecting upstream signals with downstream autophagy execution machinery. It has become an important target in both fundamental autophagy research and the development of therapies for related diseases.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for C19orf73 antibody 24856-1-AP | Download protocol |
| IHC protocol for C19orf73 antibody 24856-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |





