C1GALT1 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• C1GALT1 Polyclonal antibody (27569-1-AP)

C1GALT1 Polyclonal Antibody for WB, IF/ICC, ELISA

Cat No. 27569-1-AP Copied!

Publications (3)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, IF/ICC, ELISA

Synonyms

B3Gal T8, Beta 1,3 galactosyltransferase, C1GALT, Core 1 beta3 Gal T1, Core 1 O glycan T synthase

• 

  WB analysis of T-47D using 27569-1-AP

  T-47D cells were subjected to SDS PAGE followed by western blot with 27569-1-AP (C1GALT1 antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis using 27569-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 27569-1-AP (C1GALT1 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of HepG2 using 27569-1-AP

  HepG2 cells were subjected to SDS PAGE followed by western blot with 27569-1-AP (C1GALT1 antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of HepG2 using 27569-1-AP

  Immunofluorescent analysis of (-20°C Ethanol) fixed HepG2 cells using C1GALT1 antibody (27569-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for C1GALT1 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: MKN-45 cells, HepG2 cells, T-47D cells
• Positive IF/ICC detected in: HepG2 cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

27569-1-AP targets C1GALT1 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag26144

  Product name: Recombinant human C1GALT1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 263-363 aa of NM_020156

  Sequence: MKETFHPFVPEHHLIKGYLPRTFWYWNYNYYPPVEGPGCCSDLAVSFHYVDSTTMYELEYLVYHLRPYGYLYRYQPTLPERILKEISQANKNEDTKVKLGNP

• Full Name: core 1 synthase, glycoprotein-N-acetylgalactosamine 3-beta-galactosyltransferase, 1
• Calculated Molecular Weight: 42 kDa
• Observed Molecular Weight: 42-45 kDa
• GenBank Accession Number: NM_020156
• Gene Symbol: C1GALT1
• Gene ID (NCBI): 56913
• RRID: AB_2880912
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9NS00
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

C1GALT1 (Glycoprotein-N-acetylgalactosamine 3-beta-galactosyltransferase 1), also known as B3Gal-T8, catalyzes the transfer of galactose (Gal) from UDP-Gal to N-acetylgalactosamine (GalNAc) O-linked esters of threonine and serine residues of target proteins, including IgA1, to form the T antigen (PMID: 28209808). C1GalT1 is overexpressed in many common cancers includingcolon, breast, gastric, lung, head and neck, pancreatic, esophageal, prostate, and hepatocellular cancer (PMID: 34944925). C1GALT1 protein contains 363 amino acids and is a typeII transmembrane protein. Rate C1GalT1 is an 84/86KDa disulfide-bonded homodimer, but its active form is believed to be a 42/43 KDa monomeric protein (PMID: 34149900).

Publications

What published studies show

The C1GALT1 Polyclonal antibody (Cat# 27569-1-AP) has 3 total citations. These appear in International Immunopharmacology, Journal of Biomedical Research, and BMC Nephrology. The research fields covered include IgA nephropathy (specifically miR-98-5p-mediated IgA1 glycosylation regulation and dioscin's effect on Gd-IgA1 overproduction via IL-6/JAK2/STAT3 signaling) and gastric cancer (C1GALT1 genetic variants associated with cancer risk and immune infiltrations). Applications cited include WB and IHC in human samples.

Automatically generated from the 3 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
	WB	Int Immunopharmacol; The upregulation of miR-98-5p affects the glycosylation of IgA1 through cytokines in IgA nephropathy.; Authors - Di Liu
human	IHC	J Biomed Res; Genetic variants in C1GALT1 are associated with gastric cancer risk and immune infiltrations; Authors - Mengfan Guo
human	WB	BMC Nephrol; Dioscin attenuates Gd-IgA1 overproduction by inhibiting the IL-6-JAK2/STAT3 signaling axis in IgA nephropathy.; Authors - Lan Lin