C1QA Monoclonal antibody

• 

  WB analysis of human plasma using 67063-1-Ig

  human plasma were subjected to SDS PAGE followed by western blot with 67063-1-Ig (C1QA antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of human blood using 67063-1-Ig

  human blood were subjected to SDS PAGE followed by western blot with 67063-1-Ig (C1QA antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human liver using 67063-1-Ig

  Immunohistochemical analysis of paraffin-embedded human liver tissue slide using 67063-1-Ig (C1QA antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human liver using 67063-1-Ig

  Immunohistochemical analysis of paraffin-embedded human liver tissue slide using 67063-1-Ig (C1QA antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of HepG2 using 67063-1-Ig

  Immunofluorescent analysis of (-20°C Ethanol) fixed HepG2 cells using C1QA antibody (67063-1-Ig, Clone: 1B10E3 ) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Mouse IgG(H+L).

C1QA Monoclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 67063-1-Ig

Clone No.1B10E3

Publications(9)

Host / Isotype

Mouse / IgG1

Reactivity

human and More (1)

Applications

WB, IHC, IF/ICC, IP, ELISA

Synonyms

Complement C1q A chain, 1B10E3

---

Tested Applications

• Positive WB detected in: human plasma tissue, human blood tissue
• Positive IHC detected in: human liver tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: HepG2 cells

Recommended dilution

• Western Blot (WB): WB : 1:5000-1:50000
• Immunohistochemistry (IHC): IHC : 1:500-1:2000
• Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 2 publications below
• IHC: See 3 publications below
• IF: See 5 publications below
• IP: See 1 publications below

Product Information

67063-1-Ig targets C1QA in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human, mouse
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag28622

  Product name: Recombinant human C1QA protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-245 aa of BC030153

  Sequence: MEGPRGWLVLCVLAISLASMVTEDLCRAPDGKKGEAGRPGRRGRPGLKGEQGEPGAPGIRTGIQGLKGDQGEPGPSGNPGKVGYPGPSGPLGARGIPGIKGTKGSPGNIKDQPRPAFSAIRRNPPMGGNVVIFDTVITNQEEPYQNHSGRFVCTVPGYYYFTFQVLSQWEICLSIVSSSRGQVRRSLGFCDTTNKGLFQVVSGGMVLQLQQGDQVWVEKDPKKGHIYQGSEADSVFSGFLIFPSA

• Full Name: complement component 1, q subcomponent, A chain
• Calculated Molecular Weight: 245 aa, 26 kDa
• Observed Molecular Weight: 30 kDa
• GenBank Accession Number: BC030153
• Gene Symbol: C1QA
• Gene ID (NCBI): 712
• RRID: AB_2882373
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: P02745
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

The first component of complement, C1, is a calcium-dependent complex of the 3 subcomponents C1q, C1r, and C1s. C1q is composed of 18 polypeptide chains: six A-chains, six B-chains, and six C-chains. Each chain contains a collagen-like region located near the N terminus and a C-terminal globular region. Deficiency of C1q has been associated with lupus erythematosus and glomerulonephritis. This antibody is raised against C1qA which is the A-chain polypeptide of human complement subcomponent C1q.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
		Nature; Pathology-oriented multiplexing enables integrative disease mapping; Authors - Malte Kuehl
human	WB	Onco Targets Ther; Prognostic Implications of the Complement Protein C1Q and Its Correlation with Immune Infiltrates in Osteosarcoma.; Authors - Hanji Huang
human	IF	Cells; Human Placental Endothelial Cell and Trophoblast Heterogeneity and Differentiation Revealed by Single-Cell RNA Sequencing; Authors - Han Li
human	IHC	FASEB J; Cellular Landscape of Synovial Chondromatosis Synovium Revealed by Single-Cell RNA Sequencing; Authors - Haibo Zhao
mouse	IHC,IF	Mater Today Bio; Astragalin-functionalized ultrasmall nanoparticles modulate the complement pathway to inhibit microglial synaptic phagocytosis for reducing anesthetic neurotoxicity; Authors - Gang Wang
mouse	IF	Cell Biosci; Complement C1q-mediated microglial synaptic elimination by enhancing desialylation underlies sevoflurane-induced developmental neurotoxicity; Authors - Gang Wang