C1qC Recombinant monoclonal antibody, PBS Only

• 

  WB analysis of human plasma using 85031-5-RR (same clone as 85031-5-PBS)

  human plasma was subjected to SDS PAGE followed by western blot with 85031-5-RR (C1QC antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 85031-5-PBS in a different storage buffer formulation.

• 

  IHC staining of human cervical cancer using 85031-5-RR (same clone as 85031-5-PBS)

  Immunohistochemical analysis of paraffin-embedded human cervical cancer tissue slide using 85031-5-RR (C1qC antibody) at dilution of 1:500 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 85031-5-PBS in a different storage buffer formulation.

• 

  Affinity and Kinetic Characterization of 85031-5-RR

  Biolayer interferometry (BLl) kinetic assays of 85031-5-RR against Human C1qC were performed. The affinity constant is 1.26 nM.

C1qC Uni-rAb^® Recombinant Antibody for WB, IHC, Indirect ELISA

Cat No. 85031-5-PBS

Clone No.242624B1

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, Indirect ELISA

Synonyms

Complement C1q C chain, C1Q C, 242624B1, C1QG

---

Product Information

85031-5-PBS targets C1qC in WB, IHC, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag10400

  Product name: Recombinant human C1QC protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 27-245 aa of BC009016

  Sequence: QANTGCYGIPGMPGLPGAPGKDGYDGLPGPKGEPGIPAIPGIRGPKGQKGEPGLPGHPGKNGPMGPPGMPGVPGPMGIPGEPGEEGRYKQKFQSVFTVTRQTHQPPAPNSLIRFNAVLTNPQGDYDTSTGKFTCKVPGLYYFVYHASHTANLCVLLYRSGVKVVTFCGHTSKTNQVNSGGVLLRLQVGEEVWLAVNDYYDMVGIQGSDSVFSGFLLFPD

• Full Name: complement component 1, q subcomponent, C chain
• Calculated Molecular Weight: 245 aa, 26 kDa
• Observed Molecular Weight: 26 kDa
• GenBank Accession Number: BC009016
• Gene Symbol: C1QC
• Gene ID (NCBI): 714
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P02747
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

The first component of complement, C1, is a calcium-dependent complex of the 3 subcomponents C1q, C1r, and C1s. C1q is composed of 18 polypeptide chains: six A-chains, six B-chains, and six C-chains. Each chain contains a collagen-like region located near the N terminus and a C-terminal globular region. Deficiency of C1q has been associated with lupus erythematosus and glomerulonephritis. This antibody is raised against C1qC which is the C-chain polypeptide of human complement subcomponent C1q.