OSCP1 Polyclonal antibody

• 

  WB analysis of mouse testis using 12598-1-AP

  mouse testis tissue were subjected to SDS PAGE followed by western blot with 12598-1-AP (OSCP1 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of mouse brain using 12598-1-AP

  mouse brain tissue were subjected to SDS PAGE followed by western blot with 12598-1-AP (OSCP1 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of mouse lung using 12598-1-AP

  mouse lung tissue were subjected to SDS PAGE followed by western blot with 12598-1-AP (OSCP1 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• Featured Product
• KD/KO Validated

OSCP1 Polyclonal Antibody for WB, ELISA

Cat No. 12598-1-AP

Publications(6)

Host / Isotype

Rabbit / IgG

Reactivity

mouse and More (1)

Applications

WB, IHC, IF, ChIP, ELISA

Synonyms

C1orf102, hOSCP1, NOR1, Oxidored-nitro domain-containing protein 1

---

Tested Applications

• Positive WB detected in: mouse testis tissue, mouse brain tissue, mouse lung tissue

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• KD/KO: See 2 publications below
• WB: See 5 publications below
• IHC: See 2 publications below
• IF: See 2 publications below
• ChIP: See 1 publications below

Product Information

12598-1-AP targets OSCP1 in WB, IHC, IF, ChIP, ELISA applications and shows reactivity with mouse samples.

• Tested Reactivity: mouse
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag3209

  Product name: Recombinant human C1orf102 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-379 aa of BC018069

  Sequence: MSVRTLPLLFLNLGGEMLYILDQRLRAQNIRGDKARKVLNDIISTMFNRKFMEELFKPQELYSKKALRTVYERLAHASIMKLNQASMDKLYDLMTMAFKYQVLLCPRPKDVLLVTFNHLDTIKGFIRDSPTILQQVDETLRQLTEIYGGLSAGEFQLIRQTLLIFFQDLHIRVSMFLKDKVQNNNGRFVLPVSGPVPWGTEVPGLIRMFNNKGEEVKRIEFKHGGNYVPAPKEGSFELYGDRVLKLGTNMYSVNQPVETHVSGSSKNLASWTQESIAPNPLAKEELNFLARLMGGMEIKKPSGPEPGFRLNLFTTDEEEEQAALTRPEELSYEVINIQATQDQQRSEELARIMGEFEITEQPRLSTGKGDDLLAMMDEL

• Full Name: chromosome 1 open reading frame 102
• Calculated Molecular Weight: 379 aa, 43 kDa
• Observed Molecular Weight: 43 kDa
• GenBank Accession Number: BC018069
• Gene Symbol: OSCP1
• Gene ID (NCBI): 127700
• RRID: AB_11232418
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q8WVF1
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	J Cell Physiol; NOR1 Suppresses Cancer Stem-Like Cells Properties of Tumor Cells via the Inhibition of the AKT-GSK-3β-Wnt/β-Catenin-ALDH1A1 Signal Circuit.; Authors - Wei Wang ; KD Validated
mouse,human	WB,IF	J Cell Physiol; Abberent Expression of NOR1 Protein in Tumor Associated Macrophages Contributes to the Development of DEN-Induced Hepatocellular Carcinoma.; Authors - Shengnan Chen ; KO Validated
human	WB,IHC	Neoplasma; The tumor suppressor NOR1 suppresses cell growth, invasiveness, and tumorigenicity in glioma.; Authors - J Cai
human	WB,IHC	Oncotarget; Significance of the NOR1-FOXA1/HDAC2-Slug regulatory network in epithelial-mesenchymal transition of tumor cells.; Authors - Wei Wang
human	WB,ChIP	Cell Mol Life Sci; NOR1 promotes the osteoblastic differentiation of human periodontal ligament stem cells via TGF-β signaling pathway; Authors - Yun Wu
mouse	IF	PLoS One; CiliaCarta: An integrated and validated compendium of ciliary genes.; Authors - Teunis J P van Dam