C1orf109 Polyclonal antibody

• 

  WB analysis of LNCaP using 25552-1-AP

  WB result of C1orf109 antibody (25552-1-AP; 1:2000; incubated at room temperature for 1.5 hours) with sh-Control and sh-C1orf109 transfected LNCaP cells.

• 

  WB analysis using 25552-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 25552-1-AP (C1orf109 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours.

• Featured Product
• KD/KO Validated

C1orf109 Polyclonal Antibody for WB, ELISA

Cat No. 25552-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, ELISA

Synonyms

AFG2-interacting ribosome maturation factor, AIRIM, Ribosome biogenesis protein C1orf109

---

Tested Applications

• Positive WB detected in: K-562 cells, LNCaP cells, U-251 cells

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:6000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

25552-1-AP targets C1orf109 in WB, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag22147

  Product name: Recombinant human C1orf109 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-113 aa of BC018109

  Sequence: MTQDRPLLAVQEALKKCFPVVEEQQGLWQSALRDCQPLLSSLSNLAEQLQAAQNLRFEDVPALRAFPDLKERLRQPSSSRCETWSAAMWSECFRSMSNTQTQLALMLSCSLQQ

• Full Name: chromosome 1 open reading frame 109
• Calculated Molecular Weight: 203 aa, 23 kDa
• Observed Molecular Weight: 23 kDa
• GenBank Accession Number: BC018109
• Gene Symbol: C1orf109
• Gene ID (NCBI): 54955
• RRID: AB_3669483
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9NX04
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.