C1orf124 Recombinant monoclonal antibody

• Home
• Products
• Primary Antibodies
• Recombinant Antibodies
• C1orf124 Recombinant monoclonal antibody (86895-1-RR)

• 

  WB analysis using 86895-1-RR

  Various lysates were subjected to SDS PAGE followed by western blot with 86895-1-RR (C1orf124 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

• 

  Affinity and Kinetic Characterization of 86895-1-RR

  Biolayer interferometry (BLl) kinetic assays of 86895-1-RR against Human C1orf124 were performed. The affinity constant is below 1 pM.

C1orf124 Uni-rAb^® Recombinant Antibody for WB, ELISA

Cat No. 86895-1-RR

Clone No.251921A8

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, ELISA

Synonyms

DVC1, Spartan, DDDL1880, PRO4323, SPRTN

---

Tested Applications

• Positive WB detected in: HeLa cells, A549 cells

Recommended dilution

• Western Blot (WB): WB : 1:5000-1:50000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

86895-1-RR targets C1orf124 in WB, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag20586

  Product name: Recombinant human C1orf124 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-243 aa of BC015740

  Sequence: MDDDLMLALRLQEEWNLQEAERDHAQESLSLVDASWELVDPTPDLQALFVQFNDQFFWGQLEAVEVKWSVRMTLCAGICSYEGKGGMCSIRLSEPLLKLRPRKDLVETLLHEMIHAYLFVTNNDKDREGHGPEFCKHMHRINSLTGANITVYHTFHDEVDEYRRHWWRCNGPCQHRPPYYGYVKRATNREPSAHDYWWAEHQKTCGGTYIKIKEPENYSKKGKGKAKLGKEPVLAAENKGTFV

• Full Name: DNA-dependent metalloprotease SPRTN
• Calculated Molecular Weight: 489 aa, 55 kDa
• Observed Molecular Weight: 55/65 kDa
• GenBank Accession Number: BC015740
• Gene Symbol: Spartan
• Gene ID (NCBI): 83932
• RRID: AB_3745194
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q9H040
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Spartan (Protein with SprT-like domain at the N terminus), also known as DVC1 or C1orf124, is a replication-coupled DNA-dependent metalloprotease that cleaves proteins cross-linked to DNA to promote DPC repair (PMID: 38600235). Spartan protease activity is stimulated by DNA binding, while posttranslational modification of Spartan governs both its protease activity and recruitment to the DPC on chromatin (PMID: 27871366). The regulation of Spartan includes a ubiquitin switch (where deubiquitination activates its proteolytic activity), and acetylation and phosphorylation switches (which facilitate DNA binding). The calculated molecular weight of Spartan is 55 kDa, while the 65-kDa band could be due to posttranslational modification (PMID: 33567341, 31316063).