Draxin Polyclonal antibody

• Home
• Products
• Primary Antibodies
• Draxin Polyclonal antibody (26342-1-AP)

Draxin Polyclonal Antibody for WB, ELISA

Cat No. 26342-1-AP Copied!

Publications (2)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, ELISA

Synonyms

C1orf187, AGPA3119, Dorsal inhibitory axon guidance protein, Neucrin, PSEC0258

• 

  WB analysis of mouse cerebellum using 26342-1-AP

  mouse cerebellum tissue were subjected to SDS PAGE followed by western blot with 26342-1-AP (C1orf187 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis using 26342-1-AP

  SH-SY5Y cells were subjected to SDS PAGE followed by western blot with 26342-1-AP (C1orf187 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis using 26342-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 26342-1-AP (C1orf187 antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for Draxin in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: mouse cerebellum tissue, SH-SY5Y cells, rat cerebellum tissue, rat cerebellm tissue

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

26342-1-AP targets Draxin in WB, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag23666

  Product name: Recombinant human C1orf187 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 171-349 aa of BC021286

  Sequence: QVLDAAMEESSTSLAPTMFFLTTFEAAPATEESLILPVTSLRPQQAQPRSDGEVMPTLDMALFDWTDYEDLKPDGWPSAKKKEKHRGKLSSDGNETSPAEGEPCDHHQDCLPGTCCDLREHLCTPHNRGLNNKCFDDCMCVEGLRCYAKFHRNRRVTRRKGRCVEPETANGDQGSFINV

• Full Name: chromosome 1 open reading frame 187
• Observed Molecular Weight: 32 kDa
• GenBank Accession Number: BC021286
• Gene Symbol: C1orf187
• Gene ID (NCBI): 374946
• RRID: AB_2880483
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q8NBI3
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

C1orf187, also named Draxin(Dorsal repulsive axon guidance protein), is a repulsive axon guidance cue. It is widely expressed in the developing hippocampus, glioma, and all histological types of the lung cancer cell. Draxin was shown to bind a 22-amino-acid peptide of the EGF domain of Netrin-1, and through Draxin/Netrin-1 interaction, Draxin may act as a secreted Netrin-1 antagonist. C1orf187 can inhibit or repel neurite outgrowth from dorsal spinal cord. It inhibits the stabilization of cytosolic beta-catenin (CTNNB1) via its interaction with LRP6, thereby acting as an antagonist of Wnt signaling pathway (PMID: 29622850).

Publications

What published studies show

The Draxin (C1orf187) Polyclonal antibody (Cat# 26342-1-AP) has 2 total citations. These appear in Frontiers in Immunology (2022) and Chemical Biology and Interactions (2024). Both studies used the antibody for Western Blot in human samples. The research fields span neuro-oncology (cuproptosis-related gene signatures in lower-grade gliomas) and cancer biology (transcriptomic/proteomic analysis of p53-regulated genes in cancer cell lines).

Automatically generated from the 2 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Front Immunol; Identification of a novel cuproptosis-related gene signature and integrative analyses in patients with lower-grade gliomas; Authors - Jia-hao Bao
human	WB	Chem Biol Interact; Transcriptomic and proteomic study of cancer cell lines exposed to actinomycin D and nutlin-3a reveals numerous, novel candidates for p53-regulated genes; Authors - Barbara Łasut-Szyszka