C1orf31 Recombinant monoclonal antibody, PBS Only (Detector)

• Home
• Products
• Primary Antibodies
• Recombinant Antibodies
• C1orf31 Recombinant monoclonal antibody, PBS Only (Detector) (87188-1-PBS)

C1orf31 Uni-rAb^® Recombinant Antibody for Sandwich ELISA, Indirect ELISA

Cat No. 87188-1-PBS

Clone No.252149C10

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

Sandwich ELISA, Indirect ELISA

Synonyms

COA6

• 

  Sandwich ELISA sample test of MP02899-1

  The mean COA6 concentration was determined to be 29.93 ng/mL in K-562 cell extract based on a 1.20 mg/mL extract load, 26.48 ng/mL in HEK-293 cell extract based on a 1.20 mg/mL extract load and 8.57 ng/mL in HuH-7 cell extract based on a 1.20 mg/mL extract load.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  Sandwich ELISA standard curve of MP02899-1

  Sandwich ELISA standard curve of MP02899-1, Human COA6 Recombinant Matched Antibody Pair - PBS only. 87188-2-PBS was coated to a plate as the capture antibody and incubated with serial dilutions of standard Ag21525. 87188-1-PBS was HRP conjugated as the detection antibody. Range: 0.156-10 ng/mL.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

---

Product Information

87188-1-PBS targets C1orf31 as part of a matched antibody pair:

MP02899-1: 87188-2-PBS capture and 87188-1-PBS detection (validated in Sandwich ELISA)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag21525

  Product name: Recombinant human C1orf31 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 47-125 aa of BC116455

  Sequence: MAAPSMKERQVCWGARDEYWKCLDENLEDASQCKKLRSSFESSCPQQWIKYFDKRRDYLKFKEKFEAGQFEPSETTAKS

• Full Name: chromosome 1 open reading frame 31
• Calculated Molecular Weight: 125 aa, 14 kDa
• GenBank Accession Number: BC116455
• Gene Symbol: COA6
• Gene ID (NCBI): 388753
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q5JTJ3
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.