C1orf55 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• C1orf55 Polyclonal antibody, PBS Only (34060-1-PBS)

• 

  WB analysis using 34060-1-AP (same clone as 34060-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 34060-1-AP (C1orf55 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 34060-1-PBS in a different storage buffer formulation.

C1orf55 Polyclonal Antibody for WB, Indirect ELISA

Cat No. 34060-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, Indirect ELISA

Synonyms

Replication stress response regulator SDE2, SDE2, Splicing regulator SDE2

---

Product Information

34060-1-PBS targets C1orf55 in WB, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag41112

  Product name: Recombinant human C1orf55 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 350-451 aa of BC071563

  Sequence: DGERVAEVAPEERENVAVAKLQESQPGNAVIDKETIDLLAFTSVAELELLGLEKLKCELMALGLKCGGTLQERAARLFSVRGLAKEQIDPALFAKPLKGKKK

• Full Name: chromosome 1 open reading frame 55
• Observed Molecular Weight: 50 kDa
• GenBank Accession Number: BC071563
• Gene Symbol: C1orf55
• Gene ID (NCBI): 163859
• RRID: AB_3743146
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: Q6IQ49
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

C1orf55, also known as Nurit, is a relatively small, conserved vertebrate-specific protein that localizes to the nucleus, particularly within the nucleolus. Its precise molecular function is an active area of research, but it is implicated in fundamental cellular processes related to ribosome biogenesis, cell proliferation, and the DNA damage response.