C1orf57 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• C1orf57 Polyclonal antibody, PBS Only (21463-1-PBS)

• 

  WB analysis of A549 using 21463-1-AP (same clone as 21463-1-PBS)

  A549 cells were subjected to SDS PAGE followed by western blot with 21463-1-AP (C1orf57 antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 21463-1-PBS in a different storage buffer formulation.

• 

  WB analysis of mouse pancreas using 21463-1-AP (same clone as 21463-1-PBS)

  mouse pancreas tissue were subjected to SDS PAGE followed by western blot with 21463-1-AP (C1orf57 antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 21463-1-PBS in a different storage buffer formulation.

• 

  WB analysis of human brain using 21463-1-AP (same clone as 21463-1-PBS)

  human brain tissue were subjected to SDS PAGE followed by western blot with 21463-1-AP (C1orf57 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 21463-1-PBS in a different storage buffer formulation.

C1orf57 Polyclonal Antibody for WB, Indirect ELISA

Cat No. 21463-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, Indirect ELISA

Synonyms

---

Product Information

21463-1-PBS targets C1orf57 in WB, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag15009

  Product name: Recombinant human C1orf57 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-190 aa of BC005102

  Sequence: MARHVFLTGPPGVGKTTLIHKASEVLKSSGVPVDGFYTEEVRQGGRRIGFDVVTLSGTRGPLSRVGLEPPPGKRECRVGQYVVDLTSFEQLALPVLRNADCSSGPGQRVCVIDEIGKMELFSQLFIQAVRQTLSTPGTIILGTIPVPKGKPLALVEEIRNRKDVKVFNVTKENRNHLLPDIVTCVQSSRK

• Full Name: chromosome 1 open reading frame 57
• Calculated Molecular Weight: 190 aa, 21 kDa
• Observed Molecular Weight: 21 kDa
• GenBank Accession Number: BC005102
• Gene Symbol: C1orf57
• Gene ID (NCBI): 84284
• RRID: AB_10734586
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9BSD7
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.