SZT2 Polyclonal antibody

• 

  IP experiment of THP-1 using 26121-1-AP

  IP result of anti-C1orf84 (IP:26121-1-AP, 4ug; Detection:26121-1-AP 1:300) with THP-1 cells lysate 1640 ug.

• 

  IP experiment of HL-60 using 26121-1-AP

  IP result of anti-C1orf84 (IP:26121-1-AP, 4ug; Detection:26121-1-AP 1:300) with HL-60 cells lysate 1480 ug.

SZT2 Polyclonal Antibody for IP, ELISA

Cat No. 26121-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

IP, ELISA

Synonyms

C1orf84, KIAA0467, KICSTOR complex protein SZT2, Seizure threshold 2 protein homolog, SZT2 Subunit Of KICSTOR Complex

---

Tested Applications

• Positive IP detected in: THP-1 cells, HL-60 cells

Recommended dilution

• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

26121-1-AP targets SZT2 in IP, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag23572

  Product name: Recombinant human C1orf84 protein

  Source: e coli.-derived, PET30a

  Tag: 6*His

  Domain: 1-166 aa of BC051343

  Sequence: MASERPEPEVEEAGQVFLLMKKDYRISRNVRLAWFLSHLHQTVQATPQEMLLQSEQELEVLSVLPPGWQPDEPVVPRPFLLVPSTRVTFLAWQYRFVIELDLSPSTGIVDDSTGEILFDEVFHALSRCLGGLLRPFRVPGSCIDFQPEIYVTIQAYSSIIGLQSHQ

• Full Name: KIAA0467
• Observed Molecular Weight: 370 kDa
• GenBank Accession Number: BC051343
• Gene Symbol: C1orf84
• Gene ID (NCBI): 23334
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q5T011
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

SZT2 (Seizure Threshold 2), originally known as C1orf84, is a large protein (approximately 378 kDa) located at chromosome 1p34.2. As a core subunit of the KICSTOR complex, it localizes to the lysosomal surface and negatively regulates the mTORC1 signaling pathway by recruiting the GATOR1 complex. Loss of SZT2 function leads to constitutive activation of mTORC1, resulting in aberrant cell proliferation, overproliferation of neural stem cells, and impaired neuronal differentiation. This protein plays a critical role in nervous system development and cell growth regulation, making it an important target for research on neurodevelopmental disorders and epilepsy.