C1orf93 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• C1orf93 Polyclonal antibody (26304-1-AP)

C1orf93 Polyclonal Antibody for WB, IF-P, ELISA

Cat No. 26304-1-AP Copied!

Publications (1)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human and More (1)

Applications

WB, IF-P, ELISA

Synonyms

EC:1.11.1.20, FAM213B, Peroxiredoxin-like 2B, Prostamide/PG F synthase, Prostamide/PGF synthase

• 

  WB analysis of PC-3 using 26304-1-AP

  PC-3 cells were subjected to SDS PAGE followed by western blot with 26304-1-AP (C1orf93 Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of MCF-7 using 26304-1-AP

  MCF-7 cells were subjected to SDS PAGE followed by western blot with 26304-1-AP (C1orf93 Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of K-562 using 26304-1-AP

  K-562 cells were subjected to SDS PAGE followed by western blot with 26304-1-AP (C1orf93 Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of mouse thymus using 26304-1-AP

  Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded mouse thymus tissue using C1orf93 antibody (26304-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of mouse thymus using 26304-1-AP

  Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded mouse thymus tissue using C1orf93 antibody (26304-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for C1orf93 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: PC-3 cells, K-562 cells, MCF-7 cells
• Positive IF-P detected in: mouse thymus tissue

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000
• Immunofluorescence (IF)-P: IF-P : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

26304-1-AP targets C1orf93 in WB, IF-P, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag23669

  Product name: Recombinant human C1orf93 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-198 aa of BC022547

  Sequence: MSTVDLARVGACILKHAVTGEAVELRSLWREHACVVAGLRRFGCVVCRWIAQDLSSLAGLLDQHGVRLVGVGPEALGLQEFLDGDYFAGELYLDESKQLYKELGFKRYNSLSILPAALGKPVRDVAAKAKAVGIQGNLSGDLLQSGGLLVVSKGGDKVLLHFVQKSPGDYVPKEHILQVLGISAEVCASDPPQCDREV

• Full Name: chromosome 1 open reading frame 93
• Observed Molecular Weight: 21 kDa
• GenBank Accession Number: BC022547
• Gene Symbol: C1orf93
• Gene ID (NCBI): 127281
• RRID: AB_2880471
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q8TBF2
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

What published studies show

The C1orf93 Polyclonal antibody (Cat# 26304-1-AP) has 1 total citation. It was cited in Cell Metabolism (2024) by Ling Xiao et al., in a study on m6A mRNA methylation in brown fat regulating systemic insulin sensitivity via an inter-organ prostaglandin signaling axis independent of UCP1. The research field encompasses metabolic regulation, RNA modification (m6A), and adipose tissue biology. The antibody was applied in Western Blot (WB) for both human and mouse samples.

Automatically generated from the 1 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse,human	WB	Cell Metab; m6A mRNA methylation in brown fat regulates systemic insulin sensitivity via an inter-organ prostaglandin signaling axis independent of UCP1; Authors - Ling Xiao