Complement C2 Monoclonal antibody, PBS Only (Detector)

Complement C2 Monoclonal Antibody for Cytometric bead array, Indirect ELISA
Cat No. 60741-2-PBS
Clone No.4E1A9

Host / Isotype

Mouse / IgG2b

Reactivity

human

Applications

Cytometric bead array, Indirect ELISA

C2, 4E1A9, Complement C2b fragment, Complement C2a fragment, CO2

Formulation:  PBS Only
PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

60741-2-PBS targets Complement C2 as part of a matched antibody pair:

MP51071-1: 60741-1-PBS capture and 60741-2-PBS detection (validated in Cytometric bead array)

Unconjugated mouse monoclonal antibody pair in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity human
Host / Isotype Mouse / IgG2b
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag25690

Product name: Recombinant human C2 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 587-726 aa of BC043484

Sequence: EANLALRRPQGSTCRDHENELLNKQSVPAHFVALNGSKLNINLKMGVEWTSCAEVVSQEKTMFPNLTDVREVVTDQFLCSGTQEDESPCKGESGGAVFLERRFRFFQVGLVSWGLYNPCLGSADKNSRKRAPRSKVPPPR

Predict reactive species
Full Name complement component 2
GenBank Accession NumberBC043484
Gene Symbol C2
Gene ID (NCBI) 717
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP06681
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.
Loading...
||
New chat Able
正在加载,请稍候...