C20orf194 Polyclonal antibody

• 

  WB analysis of mouse testis using 23184-1-AP

  mouse testis tissue were subjected to SDS PAGE followed by western blot with 23184-1-AP (C20orf194 Antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of rat testis using 23184-1-AP

  rat testis tissue were subjected to SDS PAGE followed by western blot with 23184-1-AP (C20orf194 Antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human small intestine using 23184-1-AP

  Immunohistochemical analysis of paraffin-embedded human small intestine tissue slide using 23184-1-AP (C20orf194 Antibody) at dilution of 1:50 (under 10x lens).

• 

  IHC staining of human small intestine using 23184-1-AP

  Immunohistochemical analysis of paraffin-embedded human small intestine tissue slide using 23184-1-AP (C20orf194 Antibody) at dilution of 1:50 (under 40x lens).

• 

  IHC staining of human brain using 23184-1-AP

  Immunohistochemical analysis of paraffin-embedded human brain tissue slide using 23184-1-AP (C20orf194 Antibody) at dilution of 1:50 (under 10x lens).

• 

  IHC staining of human brain using 23184-1-AP

  Immunohistochemical analysis of paraffin-embedded human brain tissue slide using 23184-1-AP (C20orf194 Antibody) at dilution of 1:50 (under 40x lens).

C20orf194 Polyclonal Antibody for WB, ELISA

Cat No. 23184-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, ELISA

Synonyms

C20orf194

---

Tested Applications

• Positive WB detected in: mouse testis tissue, rat testis tissue

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

23184-1-AP targets C20orf194 in WB, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag19714

  Product name: Recombinant human C20orf194 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 568-916 aa of BC122529

  Sequence: GYTDVIDVVQALQTHPDSNVKASFTIGAITACVEPMSCYMEHRFLFPKCLDQCSQGLVSNVVFTSHTTEQRHPLLVQLQSLIRAANPAAAFILAENGIVTRNEDIELILSENSFSSPEMLRSRYLMYPGWYEGKLNAGSVYPLMVQICVWFGRPLEKTRFVAKCKAIQSSIKPSPFSGNIYHILGKVKFSDSERTMEVCYNTLANSLSIMPVLEGPTPPPDSKSVSQDSSGQQECYLVFIGCSLKEDSIKDWLRQSAKQKPQRKALKTRGMLTQQEIRSIHVKRHLEPLPAGYFYNGTQFVNFFGDKTDFHPLMDQFMNDYVEEANREIEKYNQELEQQEYHDLFELKP

• Full Name: chromosome 20 open reading frame 194
• Calculated Molecular Weight: 1177 aa, 132 kDa
• Observed Molecular Weight: 132 kDa
• GenBank Accession Number: BC122529
• Gene Symbol: C20orf194
• Gene ID (NCBI): 25943
• RRID: AB_2879227
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen Affinity purified
• UNIPROT ID: Q5TEA3
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.