C20orf26 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• C20orf26 Polyclonal antibody, PBS Only (31427-1-PBS)

• 

  IHC staining of mouse liver using 31427-1-AP (same clone as 31427-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse liver tissue slide using 31427-1-AP (C20orf26 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 31427-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse liver using 31427-1-AP (same clone as 31427-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse liver tissue slide using 31427-1-AP (C20orf26 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 31427-1-PBS in a different storage buffer formulation.

• 

  IF Staining of A431 using 31427-1-AP (same clone as 31427-1-PBS)

  Immunofluorescent analysis of (-20°C Methanol) fixed A431 cells using C20orf26 antibody (31427-1-AP) at dilution of 1:200 and Multi-rAb CoraLite ® Plus 488-Goat Anti-Rabbit Recombinant Secondary Antibody (H+L) (RGAR002). This data was developed using the same antibody clone with 31427-1-PBS in a different storage buffer formulation.

C20orf26 Polyclonal Antibody for IHC, IF/ICC, Indirect ELISA

Cat No. 31427-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

IHC, IF/ICC, Indirect ELISA

Synonyms

CFAP61, SPGF84, CaM-IP3

---

Product Information

31427-1-PBS targets C20orf26 in IHC, IF/ICC, Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag35425

  Product name: Recombinant human C20orf26 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 45-190 aa of BC031674

  Sequence: HMKFNNLTLISTHGLPGKKLLDTEQRKFLASDHCFNDKDYALMSLCSWVNVVVGRMTGIDRAAKHVVLSTDEIVPYDHLILCTGQQYQVPCPTEADISQHLTNREVPNSSQRRYTGKVPCNHFTLNEEEDCFKALIWIRNNSITTE

• Full Name: chromosome 20 open reading frame 26
• GenBank Accession Number: BC031674
• Gene Symbol: C20orf26
• Gene ID (NCBI): 26074
• RRID: AB_3669978
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: Q8NHU2
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

C20orf26, also known as CFAP61 (cilia and flagella associated protein 61), is a protein-coding gene located on human chromosome 20. The protein is predicted to be involved in cilium movement and cilium organization, and it is likely to be located in the axoneme and motile cilium. CFAP61 is also predicted to colocalize with the radial spoke stalk, which is a part of the structural framework of cilia and flagella.