C20orf3/APMAP Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• C20orf3/APMAP Polyclonal antibody, PBS Only (25953-1-PBS)

• 

  WB analysis of HepG2 using 25953-1-AP (same clone as 25953-1-PBS)

  HepG2 cells were subjected to SDS PAGE followed by western blot with 25953-1-AP (C20orf3 Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 25953-1-PBS in a different storage buffer formulation.

• 

  IP experiment of mouse liver using 25953-1-AP (same clone as 25953-1-PBS)

  IP result of anti-C20orf3/APMAP (IP:25953-1-AP, 4ug; Detection:25953-1-AP 1:300) with mouse liver tissue lysate 4800ug. This data was developed using the same antibody clone with 25953-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human kidney using 25953-1-AP (same clone as 25953-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human kidney tissue slide using 25953-1-AP (C20orf3 Antibody) at dilution of 1:200 (under 40x lens). This data was developed using the same antibody clone with 25953-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

C20orf3/APMAP Polyclonal Antibody for WB, IHC, IP, Indirect ELISA

Cat No. 25953-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, IP, Indirect ELISA

Synonyms

C20orf3, UNQ1869/PRO4305, Protein BSCv, BSCv, APMAP

---

Product Information

25953-1-PBS targets C20orf3/APMAP in WB, IHC, IP, Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag23029

  Product name: Recombinant human C20orf3 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 66-416 aa of BC003501

  Sequence: DPQPLSFKEPPLLLGVLHPNTKLRQAERLFENQLVGPESIAHIGDVMFTGTADGRVVKLENGEIETIARFGSGPCKTRDDEPVCGRPLGIRAGPNGTLFVADAYKGLFEVNPWKREVKLLLSSETPIEGKNMSFVNDLTVTQDGRKIYFTDSSSKWQRRDYLLLVMEGTDDGRLLEYDTVTREVKVLLDQLRFPNGVQLSPAEDFVLVAETTMARIRRVYVSGLMKGGADLFVENMPGFPDNIRPSSSGGYWVGMSTIRPNPGFSMLDFLSERPWIKRMIFKLFSQETVMKFVPRYSLVLELSDSGAFRRSLHDPDGLVATYISEVHEHDGHLYLGSFRSPFLCRLSLQAV

• Full Name: chromosome 20 open reading frame 3
• Calculated Molecular Weight: 416 aa, 46 kDa
• Observed Molecular Weight: 42-46 kDa
• GenBank Accession Number: BC003501
• Gene Symbol: APMAP
• Gene ID (NCBI): 57136
• RRID: AB_2880308
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9HDC9
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.