C20orf46 Polyclonal antibody

• 

  WB analysis of mouse colon using 24678-1-AP

  mouse colon tissue were subjected to SDS PAGE followed by western blot with 24678-1-AP (C20orf46 Antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

• 

  WB analysis of Jurkat using 24678-1-AP

  Jurkat cells were subjected to SDS PAGE followed by western blot with 24678-1-AP (C20orf46 Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human colon cancer using 24678-1-AP

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 24678-1-AP (C20orf46 Antibody) at dilution of 1:50 (under 10x lens).

• 

  IHC staining of human colon cancer using 24678-1-AP

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 24678-1-AP (C20orf46 Antibody) at dilution of 1:50 (under 40x lens).

• 

  IHC staining of human colon using 24678-1-AP

  Immunohistochemical analysis of paraffin-embedded human colon tissue slide using 24678-1-AP (C20orf46 Antibody) at dilution of 1:50 (under 10x lens).

• 

  IHC staining of human colon using 24678-1-AP

  Immunohistochemical analysis of paraffin-embedded human colon tissue slide using 24678-1-AP (C20orf46 Antibody) at dilution of 1:50 (under 40x lens).

C20orf46 Polyclonal Antibody for IHC, ELISA

Cat No. 24678-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

IHC, ELISA

Synonyms

C20orf46, Transmembrane protein C20orf46

---

Tested Applications

• Positive IHC detected in: human colon cancer tissue, human colon tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Immunohistochemistry (IHC): IHC : 1:20-1:200

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

24678-1-AP targets C20orf46 in IHC, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag20385

  Product name: Recombinant human C20orf46 protein

  Source: e coli.-derived, PET30a

  Tag: 6*His

  Domain: 1-122 aa of BC156781

  Sequence: MPPAQGYEFAAAKGPRDELGPSFPMASPPGLELKTLSNGPQAPRRSAPLGPVAPTREGVENACFSSEEHETHFQNPGNTRLGSSPSPPGGVSSLPRSQRDDLSLHSEEGPALEPVSRPVDYG

• Full Name: chromosome 20 open reading frame 46
• Calculated Molecular Weight: 256 aa, 28 kDa
• GenBank Accession Number: BC156781
• Gene Symbol: C20orf46
• Gene ID (NCBI): 55321
• RRID: AB_2879669
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9NUR3
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

C20orf46, also named as TMEM74B, belongs to the TMEM74 family.