SLC52A3 Polyclonal antibody

• 

  WB analysis of mouse brain using 25626-1-AP

  mouse brain tissue were subjected to SDS PAGE followed by western blot with 25626-1-AP (SLC52A3 antibody) at dilution of 1:800 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human testis using 25626-1-AP

  Immunohistochemical analysis of paraffin-embedded human testis tissue slide using 25626-1-AP (SLC52A3 antibody at dilution of 1:50 (under 10x lens).

• 

  IHC staining of human small intestine using 25626-1-AP

  Immunohistochemical analysis of paraffin-embedded human small intestine tissue slide using 25626-1-AP (SLC52A3 antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human oesophagus cancer using 25626-1-AP

  Immunohistochemical analysis of paraffin-embedded human oesophagus cancer tissue slide using 25626-1-AP (SLC52A3 antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human stomach cancer using 25626-1-AP

  Immunohistochemical analysis of paraffin-embedded human stomach cancer tissue slide using 25626-1-AP (SLC52A3 antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human stomach cancer using 25626-1-AP

  Immunohistochemical analysis of paraffin-embedded human stomach cancer tissue slide using 25626-1-AP (SLC52A3 antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse testis using 25626-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse testis tissue slide using 25626-1-AP (SLC52A3 antibody) at dilution of 1:400 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse testis using 25626-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse testis tissue slide using 25626-1-AP (SLC52A3 antibody) at dilution of 1:400 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

SLC52A3 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 25626-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, ELISA

Synonyms

C20orf54, hRFT2, RFT2, RFVT3, Riboflavin transporter 2

---

Tested Applications

• Positive WB detected in: mouse brain tissue
• Positive IHC detected in: human stomach cancer tissue, human oesophagus cancer tissue, human small intestine tissue, human testis tissue, mouse testis tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000
• Immunohistochemistry (IHC): IHC : 1:500-1:2000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

25626-1-AP targets SLC52A3 in WB, IHC, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag22315

  Product name: Recombinant human C20orf54 protein

  Source: e coli.-derived, PET30a

  Tag: 6*His

  Domain: 130-303 aa of BC009750

  Sequence: MSRLPTYYLTTFFVGEGLSGLLPALVALAQGSGLTTCVNVTEISDSVPSPVPTRETDIAQGVPRALVSALPGMEAPLSHLESRYLPAHFSPLVFFLLLSIMMACCLVAFFVLQRQPRCWEASVEDLLNDQVTLHSIRLREENDLGPAGMVDSSQGQGYLEEKAAPCCPAHLAFV

• Full Name: Solute carrier family 52, riboflavin transporter, member 3
• Calculated Molecular Weight: 469 aa, 51 kDa
• Observed Molecular Weight: 52 kDa
• GenBank Accession Number: BC009750
• Gene Symbol: SLC52A3
• Gene ID (NCBI): 113278
• RRID: AB_2880167
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9NQ40
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.