GATD3 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• GATD3 Polyclonal antibody, PBS Only (32198-1-PBS)

• 

  WB analysis using 32198-1-AP (same clone as 32198-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 32198-1-AP (C21orf33 antibody) at dilution of 1:6000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 32198-1-PBS in a different storage buffer formulation.

GATD3 Polyclonal Antibody for WB, Indirect ELISA

Cat No. 32198-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, Indirect ELISA

Synonyms

GAL3A, GATD3A, Glutamine amidotransferase-like class 1 domain-containing protein 3, mitochondrial

---

Product Information

32198-1-PBS targets GATD3 in WB, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag37527

  Product name: Recombinant human C21orf33 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 42-268 aa of BC002370

  Sequence: AARVALVLSGCGVYDGTEIHEASAILVHLSRGGAEVQIFAPDVPQMHVIDHTKGQPSEGESRNVLTESARIARGKITDLANLSAANHDAAIFPGGFGAAKNLSTFAVDGKDCKVNKEVERVLKEFHQAGKPIGLCCIAPVLAAKVLRGVEVTVGHEQEEGGKWPYAGTAEAIKALGAKHCVKEVVEAHVDQKNKVVTTPAFMCETALHYIHDGIGAMVRKVLELTGK

• Full Name: chromosome 21 open reading frame 33
• Calculated Molecular Weight: 268 aa, 28 kDa
• Observed Molecular Weight: 28 kDa
• GenBank Accession Number: BC002370
• Gene Symbol: C21orf33
• Gene ID (NCBI): 8209
• RRID: AB_3670221
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: P0DPI2
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

GATD3A is a member of glutamine amidotransferase-like class 1 domain-containing (GATD) family. GATD proteins classically generate ammonia by amidolysis from the glutamine amide nitrogen, transferring it to an acceptor substrate in a variety of anabolic reactions involving purine and pyrimidine synthesis (PMID: 9575335). GATD3A restricts the formation of AGEs in mitochondria and is a relevant target for diseases where AGE deposition is a pathological hallmark (PMID: 35307029).