C21orf58 Polyclonal antibody

• 

  IHC staining of human brain using 25024-1-AP

  Immunohistochemical analysis of paraffin-embedded human brain tissue slide using 25024-1-AP (C21orf58 Antibody) at dilution of 1:50 (under 40x lens).

• 

  IHC staining of human skin using 25024-1-AP

  Immunohistochemical analysis of paraffin-embedded human skin tissue slide using 25024-1-AP (C21orf58 Antibody) at dilution of 1:50 (under 40x lens).

• 

  IHC staining of human liver cancer using 25024-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 25024-1-AP (C21orf58 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human skin using 25024-1-AP

  Immunohistochemical analysis of paraffin-embedded human skin tissue slide using 25024-1-AP (C21orf58 Antibody) at dilution of 1:50 (under 10x lens).

• 

  IHC staining of human brain using 25024-1-AP

  Immunohistochemical analysis of paraffin-embedded human brain tissue slide using 25024-1-AP (C21orf58 Antibody) at dilution of 1:50 (under 10x lens).

C21orf58 Polyclonal Antibody for IHC, ELISA

Cat No. 25024-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

IHC, ELISA

Synonyms

chromosome 21 open reading frame 58

---

Tested Applications

• Positive IHC detected in: human liver cancer tissue, human brain tissue, human skin tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

25024-1-AP targets C21orf58 in IHC, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag21758

  Product name: Recombinant human C21orf58 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-162 aa of BC121008

  Sequence: MARSRLPATSLRKPWKLDRQKLPSPDSGHSLLCGWSPGGKARPAGNTGAWAPAEQFFPASNRTREGGGLWPPLPLQSSPAAPTMLDSSAAEQVTRLTLKLLGQKLEQERQNVEGGPEGLHLEPGNEDRPDDALQTALKRRRDLLQRLRVGPAPSERTWLSSL

• Full Name: chromosome 21 open reading frame 58
• Calculated Molecular Weight: 322 aa, 35 kDa
• GenBank Accession Number: BC121008
• Gene Symbol: C21orf58
• Gene ID (NCBI): 54058
• RRID: AB_2879854
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P58505
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.