C22orf33 Polyclonal antibody

• 

  WB analysis of human testis using 26577-1-AP

  human testis tissue were subjected to SDS PAGE followed by western blot with 26577-1-AP (C22orf33 Antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

• 

  IF Staining of mouse testis using 26577-1-AP

  Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded mouse testis tissue using C22orf33 antibody (26577-1-AP) at dilution of 1:200 and Multi-rAb CoraLite ® Plus 488-Goat Anti-Rabbit Recombinant Secondary Antibody (H+L) (RGAR002). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of U2OS using 26577-1-AP

  Immunofluorescent analysis of (-20°C Ethanol) fixed U2OS cells using 26577-1-AP (C22orf33 antibody) at dilution of 1:50 and Alexa Fluor 488-conjugated AffiniPure Goat Anti-Rabbit IgG(H+L).

C22orf33 Polyclonal Antibody for WB, IF-P, ELISA

Cat No. 26577-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IF-P, ELISA

Synonyms

Testis-expressed protein 33, Protein EAN57, EAN57, CIMIP4, Ciliary microtubule inner protein 4

---

Tested Applications

• Positive WB detected in: human testis tissue
• Positive IF-P detected in: mouse testis tissue

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:4000
• Immunofluorescence (IF)-P: IF-P : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

26577-1-AP targets C22orf33 in WB, IF-P, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag23900

  Product name: Recombinant human C22orf33 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-195 aa of BC042635

  Sequence: MDPQSRSLKNAGSRSSSRENRATSGEGAQPCQGTDDGPSLGAQDQRSTPTNQKGSIIPNNIRHKFGSNVVDQLVSEEQAQKAIDEVFEGQKRASSWPSRTQNPVEISSVFSDYYDLGYNMRSNLFRGAAEETKSLMKASYTPEVIEKSVRDLEHWHGRKTDDLGRWHQKNAMNLNLQKALEEKYGENSKSKSSKY

• Full Name: chromosome 22 open reading frame 33
• Observed Molecular Weight: 31 kDa
• GenBank Accession Number: BC042635
• Gene Symbol: C22orf33
• Gene ID (NCBI): 339669
• RRID: AB_2880558
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: O43247
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.