C2orf51 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• C2orf51 Polyclonal antibody (25464-1-AP)

• Featured Product
• KD/KO Validated

C2orf51 Polyclonal Antibody for WB, ELISA

Cat No. 25464-1-AP Copied!

Publications (1)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, ELISA

Synonyms

TEX37, Protein SPMIP9, Protein TSC21, Sperm microtubule inner protein 9, SPMIP9

• 

  WB analysis of mouse testis using 25464-1-AP

  mouse testis tissue were subjected to SDS PAGE followed by western blot with 25464-1-AP (C2orf51 Antibody) at dilution of 1:300 incubated at 4 degree celsius over night.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for C2orf51 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: mouse testis tissue

Recommended dilution

• Western Blot (WB): WB : 1:200-1:1000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

25464-1-AP targets C2orf51 in WB, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Cited Reactivity: mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag21923

  Product name: Recombinant human C2orf51 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-180 aa of BC029522

  Sequence: MAGVKYPGQDPVDLDIYQSSHMVDYQPYRKHKYSRVTPQEQAKLDAQLRDKEFYRPIPNPNPKLTDGYPAFKRPHMTAKDLGLPGFFPSQEHEATREDERKFTSTCHFTYPASHDLHLAQGDPNQVLQSADFPCLVDPKHQPAAEMAKGYLLLPGCPCLHCHIVKVPILNRWGPLMPFYQ

• Full Name: chromosome 2 open reading frame 51
• Calculated Molecular Weight: 180 aa, 21 kDa
• Observed Molecular Weight: ~35 kDa
• GenBank Accession Number: BC029522
• Gene Symbol: C2orf51
• Gene ID (NCBI): 200523
• RRID: AB_2880092
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q96LM6
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

C2orf51, also named as TEX37 and TSC21, is a protein with calculated MW 21 kDa. We always detect 35 kDa in our WB detection.

Publications

What published studies show

The C2orf51 Polyclonal antibody (Cat# 25464-1-AP) has 1 total citation. It appears in Scientific Reports, a study examining evolutionarily conserved genes (Tex37, Ccdc73, Prss55, and Nxt2) and their dispensability for fertility in mice. The research field encompasses evolutionary genetics and reproductive biology, with the antibody used in Western Blot validation in knockout mouse models.

Automatically generated from the 1 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	WB	Sci Rep; The evolutionarily conserved genes: Tex37, Ccdc73, Prss55 and Nxt2 are dispensable for fertility in mice.; Authors - Manan Khan ; KO Validated