NDUFAF7 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• NDUFAF7 Polyclonal antibody (28025-1-AP)

NDUFAF7 Polyclonal Antibody for WB, ELISA

Cat No. 28025-1-AP Copied!

Publications (1)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

Mouse, Rat, human and More (1)

Applications

WB, ELISA

Synonyms

C2orf56, NDUFAF7, PRO1853

• 

  WB analysis using 28025-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 28025-1-AP (C2orf56 antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for NDUFAF7 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: mouse heart tissue, rat heart tissue

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

28025-1-AP targets NDUFAF7 in WB, ELISA applications and shows reactivity with Mouse, Rat, human samples.

• Tested Reactivity: Mouse, Rat, human
• Cited Reactivity: mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag27590

  Product name: Recombinant human C2orf56 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 264-425 aa of BC004548

  Sequence: QHDETRDHVEVCPDAGVIIEELSQRIALTGGAALVADYGHDGTKTDTFRGFCDHKLHDVLIAPGTADLTADVDFSYLRRMAQGKVASLGPIKQHTFLKNMGIDVRLKVLLDKSNEPSVRQQLLQGYDMLMNPKKMGERFNFFALLPHQRLQGGRYQRNARQS

• Full Name: chromosome 2 open reading frame 56
• Calculated Molecular Weight: 441 aa, 49 kDa
• Observed Molecular Weight: 50 kDa
• GenBank Accession Number: BC004548
• Gene Symbol: NDUFAF7
• Gene ID (NCBI): 55471
• RRID: AB_2881039
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q7L592
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

What published studies show

The NDUFAF7 Polyclonal antibody (Cat# 28025-1-AP) has 1 citation. It appears in Geroscience (2023), a study on coordinated transcriptional upregulation of oxidative metabolism proteins in long-lived endocrine mutant mice. The research field encompasses aging biology and oxidative metabolism. The antibody was used for Western blot in mouse samples.

Automatically generated from the 1 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	WB	Geroscience; Coordinated transcriptional upregulation of oxidative metabolism proteins in long-lived endocrine mutant mice; Authors - Ahmed M Elmansi