C2orf7 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• C2orf7 Polyclonal antibody, PBS Only (20616-1-PBS)

• 

  WB analysis using 20616-1-AP (same clone as 20616-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 20616-1-AP (C2orf7 antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 20616-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 20616-1-AP (same clone as 20616-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 20616-1-AP (C2orf7 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 20616-1-PBS in a different storage buffer formulation.

C2orf7 Polyclonal Antibody for WB, Indirect ELISA

Cat No. 20616-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, Indirect ELISA

Synonyms

---

Product Information

20616-1-PBS targets C2orf7 in WB, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag14678

  Product name: Recombinant human C2orf7 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-188 aa of BC005069

  Sequence: MVPGAAGWCCLVLWLPACVAAHGFRIHDYLYFQVLSPGDIRYIFTATPAKDFGGIFHTRYEQIHLVPAEPPEACGELSNGFFIQDQIALVERGGCSFLSKTRVVQEHGGRAVIISDNAVDNDSFYVEMIQDSTQRTADIPALFLLGRDGYMIRRSLEQHGLPWAIISIPVNVTSIPTFELLQPPWTFW

• Full Name: chromosome 2 open reading frame 7
• Calculated Molecular Weight: 188 aa, 21 kDa
• Observed Molecular Weight: 21-30 kDa
• GenBank Accession Number: BC005069
• Gene Symbol: C2orf7
• Gene ID (NCBI): 84279
• RRID: AB_3085609
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9BSG0
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Protease-associated domain-containing 1 (PRADC1), also known as C2orf7, is an enigmatic secretory protein widely expressed in humans and mice. C2orf7 is a ∼30-kDa N-glycosylated secretory protein with a protease-associated domain (PMID: 31689374).