Tested Applications
| Positive IF/ICC detected in | HepG2 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
CL594-66157 targets C3/C3b/C3c in IF/ICC applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Host / Isotype | Mouse / IgG1 |
| Class | Monoclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag15955 Product name: Recombinant human C3 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 1314-1663 aa of BC150179 Sequence: ESASLLRSEETKENEGFTVTAEGKGQGTLSVVTMYHAKAKDQLTCNKFDLKVTIKPAPETEKRPQDAKNTMILEICTRYRGDQDATMSILDISMMTGFAPDTDDLKQLANGVDRYISKYELDKAFSDRNTLIIYLDKVSHSEDDCLAFKVHQYFNVELIQPGAVKVYAYYNLEESCTRFYHPEKEDGKLNKLCRDELCRCAEENCFIQKSDDKVTLEERLDKACEPGVDYVYKTRLVKVQLSNDFDEYIMAIEQTIKSGSDEVQVGQQRTFISPIKCREALKLEEKKHYLMWGLSSDFWGEKPNLSYIIGKDTWVEHWPEEDECQDEENQKQCQDLGAFTESMVVFGCPN Predict reactive species |
| Full Name | complement component 3 |
| Calculated Molecular Weight | 1663 aa, 187 kDa |
| Observed Molecular Weight | 115 kDa |
| GenBank Accession Number | BC150179 |
| Gene Symbol | C3 |
| Gene ID (NCBI) | 718 |
| RRID | AB_2883526 |
| Conjugate | CoraLite®594 Fluorescent Dye |
| Excitation/Emission Maxima Wavelengths | 588 nm / 604 nm |
| Form | Liquid |
| Purification Method | Protein G purification |
| UNIPROT ID | P01024 |
| Storage Buffer | PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3. |
| Storage Conditions | Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. |
Background Information
The complement system is an important effector which bridges the innate and adaptive immune systems (PMID: 20010915). The third component of complement, C3, plays a central role in the activation of the complement system. Its processing by C3 convertase is the central reaction in both classical and alternative complement pathways (PMID: 11414361). Human C3, composed of α and β chains (115 and 75 kDa, respectively), is cleaved into C3a and C3b by C3 convertase. C3b is further cleaved into iC3b, C3c, C3dg and C3f. This antibody raised against 1314-1663 aa of human C3 protein recognize C3 alpha chain, C3b alpha' chain, and C3c alpha' chain fragment 2.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for CL594 C3/C3b/C3c antibody CL594-66157 | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |

