C3orf22 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• C3orf22 Polyclonal antibody (32918-1-AP)

• 

  WB analysis using 32918-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 32918-1-AP (C3orf22 antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

C3orf22 Polyclonal Antibody for WB, ELISA

Cat No. 32918-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, ELISA

Synonyms

Uncharacterized protein C3orf22

---

Tested Applications

• Positive WB detected in: mouse testis tissue, rat tsetis tissue

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

32918-1-AP targets C3orf22 in WB, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag38384

  Product name: Recombinant human C3orf22 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-141 aa of BC032025

  Sequence: MDSSACKKSHQSKKWRIQAQENFAKKFPYRLSWLTEPDPEPLQPWEVTNDSNTVQLPLQKRLVPTRSIPVRGLGAPDFTSPSGSCPAPLPAPSPPPLCNLWELKLLSRRFPRQLAFLLSTRHTEAACPQTSKAAGLSRGLS

• Full Name: chromosome 3 open reading frame 22
• Calculated Molecular Weight: 141 aa, 16 kDa
• Observed Molecular Weight: 21 kDa
• GenBank Accession Number: BC032025
• Gene Symbol: C3orf22
• Gene ID (NCBI): 152065
• RRID: AB_3742787
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: Q8N5N4
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

C3orf22 is a gene located on chromosome 3 that encodes a protein known as Chromosome 3 Open Reading Frame 22. During embryonic development, C3orf22 is expressed in various tissues and organs, such as the brain, heart, and limbs. Its expression may be regulated by developmental stage-specific factors and signaling pathways.