C3orf31 Polyclonal antibody

• 

  WB analysis of LNCaP using 28137-1-AP

  LNCaP cells were subjected to SDS PAGE followed by western blot with 28137-1-AP (C3orf31 antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human kidney using 28137-1-AP

  Immunohistochemical analysis of paraffin-embedded human kidney tissue slide using 28137-1-AP (C3orf31 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human kidney using 28137-1-AP

  Immunohistochemical analysis of paraffin-embedded human kidney tissue slide using 28137-1-AP (C3orf31 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

C3orf31 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 28137-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

Human

Applications

WB, IHC, ELISA

Synonyms

C3orf31, DKFZp434E0519

---

Tested Applications

• Positive WB detected in: LNCaP cells
• Positive IHC detected in: human kidney tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:200-1:1000
• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

28137-1-AP targets C3orf31 in WB, IHC, ELISA applications and shows reactivity with Human samples.

• Tested Reactivity: Human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag26826

  Product name: Recombinant human C3orf31 protein

  Source: e coli.-derived, PET30a

  Tag: 6*His

  Domain: 1-316 aa of BC015088

  Sequence: MALQTLQSSWVTFRKILSHFPEELSLAFVYGSGVYRQAGPSSDQKNAMLDFVFTVDDPVAWHSKNLKKNWSHYSFLKVLGPKIITSIQNNYGAGVYYNSLIMCNGRLIKYGVISTNVLIEDLLNWNNLYIAGRLQKPVKIISVNEDVTLRSALDRNLKSAVTAAFLMLPESFSEEDLFIEIAGLSYSGDFRMVVGEDKTKVLNIVKPNIAHFRELYGSILQENPQVVYKSQQGWLEIDKSPEGQFTQLMTLPKTLQQQINHIMDPPGKNRDVEETLFQVAHDPDCGDVVRLGLKKSVIYSSLKLHKMWKGWLRKTS

• Full Name: chromosome 3 open reading frame 31
• Calculated Molecular Weight: 316 aa, 36 kDa
• Observed Molecular Weight: 36 kDa
• GenBank Accession Number: BC015088
• Gene Symbol: C3orf31
• Gene ID (NCBI): 132001
• RRID: AB_2881071
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q96BW9
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.