C3orf37 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• C3orf37 Polyclonal antibody, PBS Only (31791-1-PBS)

• 

  WB analysis using 31791-1-AP (same clone as 31791-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 31791-1-AP (C3orf37 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 31791-1-PBS in a different storage buffer formulation.

C3orf37 Polyclonal Antibody for WB, Indirect ELISA

Cat No. 31791-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, Indirect ELISA

Synonyms

HMCES, DC12, SRAPD1, UPF0361 protein C3orf37

---

Product Information

31791-1-PBS targets C3orf37 in WB, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag36362

  Product name: Recombinant human C3orf37 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 100-300 aa of BC009993

  Sequence: DTVMEKRSFKVPLGKGRRCVVLADGFYEWQRCQGTNQRQPYFIYFPQIKTEKSGSIGAADSPENWEKVWDNWRLLTMAGIFDCWEPPEGGDVLYSYTIITVDSCKGLSDIHHRMPAILDGEEAVSKWLDFGEVSTQEALKLIHPTENITFHAVSSVVNNSRNNTPECLAPVDLVVKKELRASGSSQRMLQWLATKSPKKED

• Full Name: chromosome 3 open reading frame 37
• Observed Molecular Weight: 36 kDa
• GenBank Accession Number: BC009993
• Gene Symbol: C3orf37
• Gene ID (NCBI): 56941
• RRID: AB_3670114
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: Q96FZ2
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

HMCES, also known as C3orf37, is a protein that is associated with the protection of abasic sites. The molecular mass of HMCES is 40 kDa and it recognizes AP sites in ssDNA at replication forks and chemically modifies the lesion to generate a DNA-protein crosslink (PMID: 30554877).