C4 Alpha Chain/C4b/C4d Polyclonal antibody

• Home
• Products
• Primary Antibodies
• C4 Alpha Chain/C4b/C4d Polyclonal antibody (22233-1-AP)

• Featured Product
• KD/KO Validated

C4 Alpha Chain/C4b/C4d Polyclonal Antibody for WB, IP, IHC, ELISA

Cat No. 22233-1-AP Copied!

Publications (19)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse and More (1)

Applications

WB, IHC, IF, IP, CoIP, ELISA

Synonyms

Acidic complement C4, C4, C4A, C4A2, C4A3, C4A4, C4A6, C4S, CO4, Complement C4 A, CPAMD2, RG

• 

  WB analysis using 22233-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 22233-1-AP (C4 Alpha Chain/C4b/C4d antibody) at dilution of 1:15000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of human blood using 22233-1-AP

  human blood were subjected to SDS PAGE followed by western blot with 22233-1-AP (C4 alpha chain/C4b/C4d antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of mouse liver using 22233-1-AP

  mouse liver tissue were subjected to SDS PAGE followed by western blot with 22233-1-AP (C4 Alpha Chain/C4b/C4d antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IP experiment of L02 using 22233-1-AP

  IP result of anti-C4 Alpha Chain/C4b/C4d (IP:22233-1-AP, 4ug; Detection:22233-1-AP 1:1000) with L02 cells lysate 2000ug.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human liver using 22233-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver tissue slide using 22233-1-AP (C4 alpha chain/C4b/C4d antibody) at dilution of 1:200 (under 10x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human liver using 22233-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver tissue slide using 22233-1-AP (C4 alpha chain/C4b/C4d antibody) at dilution of 1:200 (under 40x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for C4 Alpha Chain/C4b/C4d in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: L02 cells, human blood, mouse liver tissue
• Positive IP detected in: L02 cells
• Positive IHC detected in: human liver tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:4000-1:40000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

22233-1-AP targets C4 Alpha Chain/C4b/C4d in WB, IHC, IF, IP, CoIP, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Cited Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag17583

  Product name: Recombinant human C4A protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1017-1336 aa of BC063289

  Sequence: YLAPTLAASRYLDKTEQWSTLPPETKDHAVDLIQKGYMRIQQFRKADGSYAAWLSRDSSTWLTAFVLKVLSLAQEQVGGSPEKLQETSNWLLSQQQADGSFQDPCPVLDRSMQGGLVGNDETVALTAFVTIALHHGLAVFQDEGAEPLKQRVEASISKANSFLGEIASAGLLGAHAAAITAYALTLTKAPVDLLGVAHNNLMAMAQETGDNLYWGSVTGSQSNAVSPTQAPRNPSDPMPQAPALWIETTAYALLHLLLHEGKAEMADQAAAWLTRQGSFQGGFRSTQDTVIALDALSAYWIASHTTEERGLNVTLSSTGR

• Full Name: complement component 4A (Rodgers blood group)
• Calculated Molecular Weight: 1744 aa, 193 kDa
• Observed Molecular Weight: 80-95 kDa, 200 kDa
• GenBank Accession Number: BC063289
• Gene Symbol: C4 Gamma Chain
• Gene ID (NCBI): 720
• RRID: AB_2879042
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P0C0L4
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Complement C4, a component of the classical complement pathway, has an important role in innate immune function. C4 protein is expressed as a single chain precursor which is proteolytically cleaved into a trimer of alpha, beta, and gamma chains (molecular wights 95, 78, and 31 kDa) prior to secretion. The alpha chain is cleaved to release C4 anaphylatoxin, an antimicrobial peptide and a mediator of local inflammation. This antibody raised against 1017-1336aa of human C4-A protein can recognize C4 precursor, C4 alpha chain, C4b, and C4d.

Publications

What published studies show

The anti-C4 antibody (Cat# 22233-1-AP) has 19 total citations across journals including Nature, Brain, PNAS, Free Radical Biology and Medicine, Scientific Reports, Clinical Science, Virulence, Renal Failure, Immunobiology, Experimental Eye Research, Biomolecules & Biochemistry, Science Progress, Journal of Oral Pathology & Medicine, Transplant Direct, Cell Biochemistry & Function, Chinese Medicine, and bioRxiv. Research fields span complement immunology, neuropsychiatry (schizophrenia), neurodegeneration (ALS), diabetic kidney disease, viral myocarditis, intracerebral hemorrhage, cancer, myopia, and transplant rejection.

Automatically generated from the 19 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Nature; Granzyme K activates the entire complement cascade; Authors - Carlos A Donado
		Brain; Extracellular vesicle biomarkers for complement dysfunction in schizophrenia; Authors - Ting Xue
human	WB,IF	Proc Natl Acad Sci U S A; Peripheral complement C4 protein in schizophrenia: Association with gene copy number and immune cell subtypes.; Authors - Agnieszka Kalinowski
mouse	WB,CoIP	Free Radic Biol Med; Complement components regulates ferroptosis in CVB3 viral myocarditis by interatction with TFRC; Authors - Lu Yi ; KD Validated
rat	WB	Chin Med; Yuye Jinhua Qingre Tablets Attenuate Acute Pharyngitis by inhibiting the Complement Cascade and C5a/C5aR1 Axis.; Authors - Yifei Gao
		Clin Sci (Lond); Differential activation of proximal complement pathways and therapeutic potential of CD55 overexpression in intracerebral hemorrhage.; Authors - Yinuo Li