C4orf26 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• C4orf26 Polyclonal antibody, PBS Only (30132-1-PBS)

• 

  IHC staining of human placenta using 30132-1-AP (same clone as 30132-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human placenta tissue slide using 30132-1-AP (C4orf26 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 30132-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human placenta using 30132-1-AP (same clone as 30132-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human placenta tissue slide using 30132-1-AP (C4orf26 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 30132-1-PBS in a different storage buffer formulation.

C4orf26 Polyclonal Antibody for IHC, Indirect ELISA

Cat No. 30132-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

IHC, Indirect ELISA

Synonyms

ODAPH, FLJ23657

---

Product Information

30132-1-PBS targets C4orf26 in IHC, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag32600

  Product name: Recombinant human C4orf26 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 24-130 aa of NM_001206981

  Sequence: QEEVFTPPGDSQNNADATDCQIFTLTPPPAPRSPVTRAQPITKTPRCPFHFFPRRPRIHFRFPNRPFVPSRCNHRFPFQPFYWPHRYLTYRYFPRRRLQRGSSSEES

• Full Name: chromosome 4 open reading frame 26
• Calculated Molecular Weight: 16kd
• GenBank Accession Number: NM_001206981
• Gene Symbol: C4orf26
• Gene ID (NCBI): 152816
• RRID: AB_3086240
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q17RF5
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Chromosome 4 open reading frame 26 (C4orf26), also known as odontogenesis associated phosphoprotein (ODAPH), is an enamel matrix protein at the maturation stage. It has been reported that mutations in C4orf26 gene are associated with autosomal recessive type of Amelogenesis Imperfecta (AI), a hereditary condition that affects enamel formation/mineralization (PMID: 33884476; PMID: 36163390).