C4orf7 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• C4orf7 Polyclonal antibody (26057-1-AP)

C4orf7 Polyclonal Antibody for WB, ELISA

Cat No. 26057-1-AP Copied!

Publications (1)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, ELISA

Synonyms

FDC secreted protein, FDC SP, FDCSP, FDC-SP, UNQ733/PRO1419

• 

  WB analysis of K-562 using 26057-1-AP

  K-562 cells were subjected to SDS PAGE followed by western blot with 26057-1-AP (C4orf7 Antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for C4orf7 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: K-562 cells

Recommended dilution

• Western Blot (WB): WB : 1:200-1:1000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

26057-1-AP targets C4orf7 in WB, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag22028

  Product name: Recombinant human C4orf7 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 18-85 aa of BC062213

  Sequence: FPVSQDQEREKRSISDSDELASGFFVFPYPYPFRPLPPIPFPRFPWFRRNFPIPIPESAPTTPLPSEK

• Full Name: chromosome 4 open reading frame 7
• Calculated Molecular Weight: 85 aa, 10 kDa
• Observed Molecular Weight: 8 kDa
• GenBank Accession Number: BC062213
• Gene Symbol: C4orf7
• Gene ID (NCBI): 260436
• RRID: AB_2880355
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q8NFU4
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

What published studies show

The C4orf7 Polyclonal antibody (Cat# 26057-1-AP) has 1 total citation. It appears in the American Journal of Translational Research (Am J Transl Res), in a study investigating how C4orf7 modulates osteogenesis and adipogenesis in human periodontal ligament cells. The cited application was Western blot (WB). The research field encompasses bone biology, periodontal tissue biology, and cell differentiation.

Automatically generated from the 1 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
	WB	Am J Transl Res; C4orf7 modulates osteogenesis and adipogenesis of human periodontal ligament cells.; Authors - Yun Wu