Tested Applications
| Positive WB detected in | human plasma tissue, rabbit serum |
| Positive IF/ICC detected in | HepG2 cells |
| Positive FC (Intra) detected in | HepG2 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:5000-1:50000 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:400-1:1600 |
| Flow Cytometry (FC) (INTRA) | FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| WB | See 2 publications below |
| ELISA | See 1 publications below |
Product Information
66634-1-Ig targets C5 in WB, IF/ICC, FC (Intra), ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Cited Reactivity | human |
| Host / Isotype | Mouse / IgG2a |
| Class | Monoclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag17882 Product name: Recombinant human C5, C5a protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 1418-1676 aa of BC113740 Sequence: GSSHAVMDISLPTGISANEEDLKALVEGVDQLFTDYQIKDGHVILQLNSIPSSDFLCVRFRIFELFEVGFLSPATFTVYEYHRPDKQCTMFYSTSNIKIQKVCEGAACKCVEADCGQMQEELDLTISAETRKQTACKPEIAYAYKVSITSITVENVFVKYKATLLDIYKTGEAVAEKDSEITFIKKVTCTNAELVKGRQYLIMGKEALQIKYNFSFRYIYPLDSLTWIEYWPRDTTCSSCQAFLANLDEFAEDIFLNGC Predict reactive species |
| Full Name | complement component 5 |
| Calculated Molecular Weight | 1676 aa, 188 kDa |
| Observed Molecular Weight | 115 kDa |
| GenBank Accession Number | BC113740 |
| Gene Symbol | C5 |
| Gene ID (NCBI) | 727 |
| RRID | AB_2881993 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein A purification |
| UNIPROT ID | P01031 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
The complement system is an important effector that bridges the innate and adaptive immune systems. The fifth component of complement, C5, is part of the complement cascade and plays an important role in inflammation and cell killing. It consists of disulfide-linked alpha and beta polypeptide chains but can be cleaved into two active peptides (C5a and C5b) by C5 convertases. Mutations and defects in C5 are associated with severe recurrent infections. (PMID: 20010915; PMID: 8011297; PMID: 6554279)
Protocols
| Product Specific Protocols | |
|---|---|
| FC protocol for C5 antibody 66634-1-Ig | Download protocol |
| IF protocol for C5 antibody 66634-1-Ig | Download protocol |
| WB protocol for C5 antibody 66634-1-Ig | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Mol Cell Proteomics Proteomic landscape of exosomes reveals the functional contributions of CD151 in triple-negative breast cancer. | ||
Virulence Streptococcus suis subtilisin-like serine proteases SspA-1 and SspA-2 interplay with complement C3a and C5a to facilitate bacterial immune evasion and infection |
Reviews
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
FH Neil (Verified Customer) (05-10-2019) | Unfortunately the C5 antibody did not perform as well as I had hoped. Either the gel was not prepared properly, or the antibody bound indiscriminately to the gel.
|









