Tested Applications
| Positive WB detected in | mouse serum |
| Positive IHC detected in | mouse liver tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:2000 |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
32767-1-AP targets C5a in WB, IHC, ELISA applications and shows reactivity with mouse samples.
| Tested Reactivity | mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Eg3332 Product name: Recombinant Mouse C5 protein (rFc Tag) (HPLC verified) Source: mammalian cells-derived, pHZ-KIsec-C-rFc Tag: C-rFc Domain: 679-755 aa of NM_010406.2 Sequence: NLHLLRQKIEEQAAKYKHSVPKKCCYDGARVNFYETCEERVARVTIGPLCIRAFNECCTIANKIRKESPHKPVQLGR Predict reactive species |
| Full Name | hemolytic complement |
| Calculated Molecular Weight | 189kDa |
| Observed Molecular Weight | 110-120 kDa |
| GenBank Accession Number | NM_010406.2 |
| Gene Symbol | Hc |
| Gene ID (NCBI) | 15139 |
| RRID | AB_3742739 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity Purification |
| UNIPROT ID | P06684 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
The complement system is an important effector that bridges the innate and adaptive immune systems. The fifth component of complement, C5, is part of the complement cascade and plays an important role in inflammation and cell killing. It consists of disulfide-linked alpha and beta polypeptide chains but can be cleaved into two active peptides (C5a and C5b) by C5 convertases. Mutations and defects in C5 are associated with severe recurrent infections
Protocols
| Product Specific Protocols | |
|---|---|
| IHC protocol for C5a antibody 32767-1-AP | Download protocol |
| WB protocol for C5a antibody 32767-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |



