KHDC3L Polyclonal antibody

• 

  WB analysis of human testis using 24989-1-AP

  human testis tissue were subjected to SDS PAGE followed by western blot with 24989-1-AP (KHDC3L antibody at dilution of 1:600 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human liver cancer using 24989-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 24989-1-AP (KHDC3L antibody at dilution of 1:50 (under 10x lens).

• 

  IHC staining of human colon cancer using 24989-1-AP

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 24989-1-AP (KHDC3L antibody) at dilution of 1:200 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of HepG2 using 24989-1-AP

  Immunofluorescent analysis of (-20°C Ethanol) fixed HepG2 cells using KHDC3L antibody (24989-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2).

KHDC3L Polyclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 24989-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, IF/ICC, ELISA

Synonyms

C6orf221, Filia, ECAT1, ES cell-associated transcript 1 protein, KH domain-containing protein 3

---

Tested Applications

• Positive WB detected in: human testis tissue
• Positive IHC detected in: human colon cancer tissue, human liver cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: HepG2 cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000
• Immunohistochemistry (IHC): IHC : 1:50-1:500
• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

24989-1-AP targets KHDC3L in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag21790

  Product name: Recombinant human C6orf221 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-217 aa of BC137160

  Sequence: MDAPRRFPTLVQLMQPKAMPVEVLGHLPKRFSWFHSEFLKNPKVVRLEVWLVEKIFGRGGERIPHVQGMSQILIHVNRLDPNGEAEILVFGRPSYQEDTIKMIMNLADYHRQLQAKGSGKALAQDVATQKAETQRSSIEVREAGTQRSVEVREAGTQRSVEVQEVGTQGSPVEVQEAGTQQSLQAANKSGTQRSPEAASKAVTQRFREDARDPVTRL

• Full Name: chromosome 6 open reading frame 221
• Calculated Molecular Weight: 217 aa, 24 kDa
• Observed Molecular Weight: 21-24 kDa
• GenBank Accession Number: BC137160
• Gene Symbol: KHDC3L
• Gene ID (NCBI): 154288
• RRID: AB_2879833
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q587J8
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

KHDC3L (also known as Filia and ES cell-associated transcript1 [Ecat1]) as a key regulator in safeguarding the genomic stability of mouse early embryonic cells. KHDC3L is critical in preventing the replication associated DNA DSBs in epiblast cells (PMID: 29125140). Importantly, by analyzing KHDC3L mutations causes recurrent pregnancy loss by inducing genomic instability of human early embryonic cells (PMID: 31609975).