KHDC3L Polyclonal antibody

KHDC3L Polyclonal Antibody for WB, IHC, IF/ICC, ELISA
Cat No. 24989-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, IF/ICC, ELISA

C6orf221, Filia, ECAT1, ES cell-associated transcript 1 protein, KH domain-containing protein 3

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inhuman testis tissue
Positive IHC detected inhuman colon cancer tissue, human liver cancer tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inHepG2 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:500-1:1000
Immunohistochemistry (IHC)IHC : 1:50-1:500
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

24989-1-AP targets KHDC3L in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human samples.

Tested Reactivity human
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag21790

Product name: Recombinant human C6orf221 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 1-217 aa of BC137160

Sequence: MDAPRRFPTLVQLMQPKAMPVEVLGHLPKRFSWFHSEFLKNPKVVRLEVWLVEKIFGRGGERIPHVQGMSQILIHVNRLDPNGEAEILVFGRPSYQEDTIKMIMNLADYHRQLQAKGSGKALAQDVATQKAETQRSSIEVREAGTQRSVEVREAGTQRSVEVQEVGTQGSPVEVQEAGTQQSLQAANKSGTQRSPEAASKAVTQRFREDARDPVTRL

Predict reactive species
Full Name chromosome 6 open reading frame 221
Calculated Molecular Weight 217 aa, 24 kDa
Observed Molecular Weight 21-24 kDa
GenBank Accession NumberBC137160
Gene Symbol KHDC3L
Gene ID (NCBI) 154288
RRIDAB_2879833
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ587J8
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

KHDC3L (also known as Filia and ES cell-associated transcript1 [Ecat1]) as a key regulator in safeguarding the genomic stability of mouse early embryonic cells. KHDC3L is critical in preventing the replication associated DNA DSBs in epiblast cells (PMID: 29125140). Importantly, by analyzing KHDC3L mutations causes recurrent pregnancy loss by inducing genomic instability of human early embryonic cells (PMID: 31609975).

Protocols

Product Specific Protocols
IF protocol for KHDC3L antibody 24989-1-APDownload protocol
IHC protocol for KHDC3L antibody 24989-1-APDownload protocol
WB protocol for KHDC3L antibody 24989-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...