C9orf114 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• C9orf114 Polyclonal antibody (33571-1-AP)

• 

  WB analysis using 33571-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 33571-1-AP (C9orf114 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

C9orf114 Polyclonal Antibody for WB, ELISA

Cat No. 33571-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, ELISA

Synonyms

CENP-32, Centromere protein 32, EC:2.1.1.-, Kinetochore-associated protein, Putative methyltransferase C9orf114

---

Tested Applications

• Positive WB detected in: K-562 cells, MCF-7 cells

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:4000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

33571-1-AP targets C9orf114 in WB, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag38014

  Product name: Recombinant human C9orf114 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 163-340 aa of BC063644

  Sequence: HQDLQFAGLLNPLDSPHHMRQDEESEFREGIVVDRPTRPGHGSFVNCGMKKEVKIDKNLEPGLRVTVRLNQQQHPDCKTYHGKVVSSQDPRTKAGLYWGYTVRLASCLSAVFAEAPFQDGYDLTIGTSERGSDVASAQLPNFRHALVVFGGLQGLEAGADADPNLEVAEPSVLFDLYV

• Full Name: chromosome 9 open reading frame 114
• Observed Molecular Weight: 40 kDa
• GenBank Accession Number: BC063644
• Gene Symbol: C9orf114
• Gene ID (NCBI): 51490
• RRID: AB_3743014
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: Q5T280
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

SPOUT1 (SPOUT domain-containing methyltransferase 1), also known as CENP32 or C9orf114, is a methyltransferase containing a SPOUT domain. This protein is highly expressed in the nucleolus and is crucial for ribosome function. SPOUT1 has been identified as an essential protein for cell survival in both Drosophila and humans. Moreover, mutations in SPOUT1 are associated with developmental epileptic encephalopathy (DEE) in humans, characterized by infantile seizures and intellectual disability.