C9orf117 Polyclonal antibody

• 

  WB analysis using 21012-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 21012-1-AP (C9orf117 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of mouse brain using 21012-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 21012-1-AP (C9orf117 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse brain using 21012-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 21012-1-AP (C9orf117 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of A549 using 21012-1-AP

  Immunofluorescent analysis of (-20°C Methanol) fixed A549 cells using C9orf117 antibody (21012-1-AP) at dilution of 1:500 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2).

C9orf117 Polyclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 21012-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, IF/ICC, ELISA

Synonyms

AFAF, Cilia- and flagella-associated protein 157, EQTN, Equatorin

---

Tested Applications

• Positive WB detected in: COLO 320 cells, Raji cells
• Positive IHC detected in: mouse brain tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: A549 cells

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:6000
• Immunohistochemistry (IHC): IHC : 1:50-1:500
• Immunofluorescence (IF)/ICC: IF/ICC : 1:250-1:1000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

21012-1-AP targets C9orf117 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag15234

  Product name: Recombinant human C9orf117 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-350 aa of BC141809

  Sequence: MAPKKSVSKAGKELEVKKKGGKKEPVVAVEPPLAKEMKEFYHIQIRDLEDRLARYQRKWDELAVQEKMFRQEFEQLANNKKEIVAFLKRTLNQQVDEITDLNEQLQNLQLAKEMEKDAFEAQLAQVRHEFQETKDQLTTENIILGGKLAALEEFRLQKEEVTDKFTLLEEQVRKQENEFRDYAYNLEKKSVLDKDRLRKEIIQRVNLVANEFHKVTTNRMWETTKRAIKENNGITLQMARVSQQGMKLLQENEQLKGRQNNLCKQLELLENTQKVMARHKRGHQKIILMLTKKCQEQQQDTKEAEELRLLLSQLEQRSLQLQVDNQALKSQRDQLSLQLEQQQVDLQRLQ

• Full Name: chromosome 9 open reading frame 117
• Calculated Molecular Weight: 520 aa, 61 kDa
• Observed Molecular Weight: 60 kDa
• GenBank Accession Number: BC141809
• Gene Symbol: C9orf117
• Gene ID (NCBI): 286207
• RRID: AB_3669353
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q5JU67
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

C9orf117 (Cilia- and flagella-associated protein 157, CFAP157) protein localizes to basal bodies and interacts with tubulin and the centrosomal protein CEP350 (PMID: 27965440).