C9orf169 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• C9orf169 Polyclonal antibody, PBS Only (33316-1-PBS)

• 

  WB analysis using 33316-1-AP (same clone as 33316-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 33316-1-AP (C9orf169 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 33316-1-PBS in a different storage buffer formulation.

C9orf169 Polyclonal Antibody for WB, Indirect ELISA

Cat No. 33316-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

Synonyms

CYSRT1, Cysteine-rich tail protein 1

---

Product Information

33316-1-PBS targets C9orf169 in applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag37408

  Product name: Recombinant human C9orf169 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-144 aa of BC052297

  Sequence: MDPQEMVVKNPYAHISIPRAHLRPDLGQQLEVASTCSSSSEMQPLPVGPCAPEPTHLLQPTEVPGPKGAKGNQGAAPIQNQQAWQQPGNPYSSSQRQAGLTYAGPPPVGRGDDIAHHCCCCPCCHCCHCPPFCRCHSCCCCVIS

• Full Name: chromosome 9 open reading frame 169
• Calculated Molecular Weight: 144 aa, 15 kDa
• Observed Molecular Weight: 18 kDa
• GenBank Accession Number: BC052297
• Gene Symbol: C9orf169
• Gene ID (NCBI): 375791
• RRID: AB_3742937
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: A8MQ03
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

CYSRT1 is highly conserved among vertebrates and has putative antimicrobial activity. CYSRT1 colocalizes with LCE proteins and contributes to the constitutive epidermal antimicrobial host defense repertoire (PMID: 36804407).