C9orf80 Polyclonal antibody

• 

  IHC staining of mouse brain using 26127-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 26127-1-AP (C9orf80 antibody) at dilution of 1:400 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse brain using 26127-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 26127-1-AP (C9orf80 antibody) at dilution of 1:400 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of U2OS using 26127-1-AP

  Immunofluorescent analysis of (4% PFA) fixed U2OS cells using C9orf80 antibody (26127-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2), CL594-Phalloidin (red).

C9orf80 Polyclonal Antibody for IHC, IF/ICC, ELISA

Cat No. 26127-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

IHC, IF/ICC, ELISA

Synonyms

SOSS C, Sensor of ssDNA subunit C, INIP, hSSBIP1, HSPC291

---

Tested Applications

• Positive IHC detected in: mouse brain tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: U2OS cells

Recommended dilution

• Immunohistochemistry (IHC): IHC : 1:200-1:800
• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

26127-1-AP targets C9orf80 in IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag23582

  Product name: Recombinant human C9orf80 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-104 aa of BC014881

  Sequence: MAANSSGQGFQNKNRVAILAELDKEKRKLLMQNQSSTNHPGASIALSRPSLNKDFRDHAEQQHIAAQQKAALQHAHAHSSGYFITQDSAFGNLILPVLPRLDPE

• Full Name: chromosome 9 open reading frame 80
• GenBank Accession Number: BC014881
• Gene Symbol: C9orf80
• Gene ID (NCBI): 58493
• RRID: AB_3669523
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9NRY2
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

C9orf80 (INIP) is also a nuclear protein related to protein synthesis and transportation. C9orf80 is a member of the core hSSB1 complex, which plays an important role in DNA damage response and genome stability maintenance(PMID: 23986477).