CA1 Recombinant monoclonal antibody, PBS Only

• 

  WB analysis using 86000-1-RR (same clone as 86000-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 86000-1-RR (CA1 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 86000-1-PBS in a different storage buffer formulation.

• 

  Affinity and Kinetic Characterization of 86000-1-RR

  Biolayer interferometry (BLl) kinetic assays of 86000-1-RR against Human CA1 were performed. The affinity constant is 2.78 nM.

CA1 Uni-rAb^® Recombinant Antibody for WB, Indirect ELISA

Cat No. 86000-1-PBS

Clone No.250632A9

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, Indirect ELISA

Synonyms

CA I, CAB, CA-I, Car1, Carbonate dehydratase I

---

Product Information

86000-1-PBS targets CA1 in WB, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag3932

  Product name: Recombinant human CA1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-261 aa of BC027890

  Sequence: MASPDWGYDDKNGPEQWSKLYPIANGNNQSPVDIKTSETKHDTSLKPISVSYNPATAKEIINVGHSFHVNFEDNDNRSVLKGGPFSDSYRLFQFHFHWGSTNEHGSEHTVDGVKYSAELHVAHWNSAKYSSLAEAASKADGLAVIGVLMKVGEANPKLQKVLDALQAIKTKGKRAPFTNFDPSTLLPSSLDFWTYPGSLTHPPLYESVTWIICKESISVSSEQLAQFRSLLSNVEGDNAVPMQHNNRPTQPLKGRTVRASF

• Full Name: carbonic anhydrase I
• Calculated Molecular Weight: 261 aa, 29 kDa
• Observed Molecular Weight: 29 kDa
• GenBank Accession Number: BC027890
• Gene Symbol: CA1
• Gene ID (NCBI): 759
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P00915
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

CA1(Carbonic anhydrase 1) is also named as CAB and belongs to the alpha-carbonic anhydrase family, which may reside in cytoplasm, in mitochondria, or in secretory granules, or associate with membranes in cell. It forms a large family of genes encoding zinc metalloenzymes of great physiologic importance. Extracellular CA1 mediates hemorrhagic retinal and cerebral vascular permeability through prekallikrein activation(PMID:17259996).