CA10 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• CA10 Polyclonal antibody, PBS Only (12953-1-PBS)

• 

  IHC staining of human gliomas using 12953-1-AP (same clone as 12953-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human gliomas tissue slide using 12953-1-AP (CA10 antibody) at dilution of 1:200 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 12953-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human gliomas using 12953-1-AP (same clone as 12953-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human gliomas tissue slide using 12953-1-AP (CA10 antibody) at dilution of 1:200 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 12953-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

CA10 Polyclonal Antibody for IHC, Indirect ELISA

Cat No. 12953-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

IHC, Indirect ELISA

Synonyms

---

Product Information

12953-1-PBS targets CA10 in IHC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag3652

  Product name: Recombinant human CA10 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 29-328 aa of BC020577

  Sequence: HEGWWAYKEVVQGSFVPVPSFWGLVNSAWNLCSVGKRQSPVNIETSHMIFDPFLTPLRINTGGRKVSGTMYNTGRHVSLRLDKEHLVNISGGPMTYSHRLEEIRLHFGSEDSQGSEHLLNGQAFSGEVQLIHYNHELYTNVTEAAKSPNGLVVVSIFIKVSDSSNPFLNRMLNRDTITRITYKNDAYLLQGLNIEELYPETSSFITYDGSMTIPPCYETASWIIMNKPVYITRMQMHSLRLLSQNQPSQIFLSMSDNFRPVQPLNNRCIRTNINFSLQGKDCPNNRAQKLQYRVNEWLLK

• Full Name: carbonic anhydrase X
• Calculated Molecular Weight: 328 aa, 38 kDa
• Observed Molecular Weight: 40 kDa
• GenBank Accession Number: BC020577
• Gene Symbol: CA10
• Gene ID (NCBI): 56934
• RRID: AB_2877897
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9NS85
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.