Tested Applications
| Positive IF/ICC detected in | U2OS cells |
| Positive FC (Intra) detected in | A431 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
| Flow Cytometry (FC) (INTRA) | FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
CL488-83082-4 targets CA11 in IF/ICC applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Recombinant |
| Type | Antibody |
| Immunogen |
CatNo: Ag33373 Product name: Recombinant human CA11 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 215-328 aa of BC002662 Sequence: DAYFLQDLSLELLFPESFGFITYQGSLSTPPCSETVTWILIDRALNITSLQMHSLRLLSQNPPSQIFQSLSGNSRPLQPLAHRALRGNRDPRHPERRCRGPNYRLHVDGVPHGR Predict reactive species |
| Full Name | carbonic anhydrase XI |
| Calculated Molecular Weight | 36 kDa |
| GenBank Accession Number | BC002662 |
| Gene Symbol | CA11 |
| Gene ID (NCBI) | 770 |
| RRID | AB_3673181 |
| Conjugate | CoraLite® Plus 488 Fluorescent Dye |
| Excitation/Emission Maxima Wavelengths | 493 nm / 522 nm |
| Form | Liquid |
| Purification Method | Protein A purification |
| UNIPROT ID | O75493 |
| Storage Buffer | PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3. |
| Storage Conditions | Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. |
Background Information
CA11(Carbonic anhydrase-related protein 11) is also named CARP2, and CARP XI and belongs to the alpha-carbonic anhydrase family. CARP XI is observed in the cerebellum, cerebrum, liver, stomach, small intestine, colon, kidney, and testis by immunohistochemical, and in the cerebellum, the most prominent signal is located in the Purkinje cells(PMID:20356370). CARP XI contains a hydrophobic N-terminal region for a possible signal sequence and asparagine glycosylation site and it plays a general role in the human central nervous system(PMID: 10350627).
Protocols
| Product Specific Protocols | |
|---|---|
| FC protocol for CL Plus 488 CA11 antibody CL488-83082-4 | Download protocol |
| IF protocol for CL Plus 488 CA11 antibody CL488-83082-4 | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |



