CA11 Recombinant monoclonal antibody

• 

  IF Staining of U2OS using 83082-4-RR

  Immunofluorescent analysis of (4% PFA) fixed U2OS cells using CA11 antibody (83082-4-RR, Clone: 230390F7 ) at dilution of 1:250 and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L) (SA00013-1), CL594-Phalloidin (red).

• 

  FC experiment of A431 using 83082-4-RR

  1x10^6 A431 cells were intracellularly stained with 0.25 ug CA11 Recombinant antibody (83082-4-RR, Clone:230390F7) and APC-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L)(red), or 0.25 ug rabbit IgG isotype control (blue). Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer.

• 

  Affinity and Kinetic Characterization of 83082-4-RR

  Biolayer interferometry (BLl) kinetic assays of 83042-4-RR against Human CA11 were performed. The affinity constant is 0.78 nM.

CA11 Uni-rAb^® Recombinant Antibody for IF/ICC, FC (Intra), ELISA

Cat No. 83082-4-RR

Clone No.230390F7

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

IF/ICC, FC (Intra), ELISA

Synonyms

230390F7, CA RP II, CA RP XI, CA XI, carbonic anhydrase XI

---

Tested Applications

• Positive IF/ICC detected in: U2OS cells
• Positive FC (Intra) detected in: A431 cells

Recommended dilution

• Immunofluorescence (IF)/ICC: IF/ICC : 1:125-1:500
• Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

83082-4-RR targets CA11 in IF/ICC, FC (Intra), ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag33373

  Product name: Recombinant human CA11 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 215-328 aa of BC002662

  Sequence: DAYFLQDLSLELLFPESFGFITYQGSLSTPPCSETVTWILIDRALNITSLQMHSLRLLSQNPPSQIFQSLSGNSRPLQPLAHRALRGNRDPRHPERRCRGPNYRLHVDGVPHGR

• Full Name: carbonic anhydrase XI
• Calculated Molecular Weight: 36 kDa
• GenBank Accession Number: BC002662
• Gene Symbol: CA11
• Gene ID (NCBI): 770
• RRID: AB_3670799
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purfication
• UNIPROT ID: O75493
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

CA11(Carbonic anhydrase-related protein 11) is also named CARP2, and CARP XI and belongs to the alpha-carbonic anhydrase family. CARP XI is observed in the cerebellum, cerebrum, liver, stomach, small intestine, colon, kidney, and testis by immunohistochemical, and in the cerebellum, the most prominent signal is located in the Purkinje cells(PMID:20356370). CARP XI contains a hydrophobic N-terminal region for a possible signal sequence and asparagine glycosylation site and it plays a general role in the human central nervous system(PMID: 10350627).