Carbonic Anhydrase 4/CA4 Polyclonal antibody

• 

  WB analysis using 13931-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 13931-1-AP (Carbonic Anhydrase 4/CA4 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of mouse lung using 13931-1-AP

  mouse lung tissue were subjected to SDS PAGE followed by western blot with 13931-1-AP (Carbonic Anhydrase 4/CA4 Antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

• 

  WB analysis of rat lung using 13931-1-AP

  rat lung tissue were subjected to SDS PAGE followed by western blot with 13931-1-AP (Carbonic Anhydrase 4/CA4 Antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human colon cancer using 13931-1-AP

  Immunohistochemical analysis of paraffin-embedded Colorectal cancer slide using 13931-1-AP (Carbonic Anhydrase 4/CA4 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human colon cancer using 13931-1-AP

  Immunohistochemical analysis of paraffin-embedded Colorectal cancer slide using 13931-1-AP (Carbonic Anhydrase 4/CA4 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

Carbonic Anhydrase 4/CA4 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 13931-1-AP

Publications(5)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF, ELISA

Synonyms

CA4, CA IV, CAIV, CA-IV, Car4

---

Tested Applications

• Positive WB detected in: mouse lung tissue, rat lung tissue
• Positive IHC detected in: human colon cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 2 publications below
• IHC: See 2 publications below
• IF: See 1 publications below

Product Information

13931-1-AP targets Carbonic Anhydrase 4/CA4 in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag4960

  Product name: Recombinant human CA4 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 17-284 aa of BC057792

  Sequence: ASAESHWCYEVQAESSNYPCLVPVKWGGNCQKDRQSPINIVTTKAKVDKKLGRFFFSGYDKKQTWTVQNNGHSVMMLLENKASISGGGLPAPYQAKQLHLHWSDLPYKGSEHSLDGEHFAMEMHIVHEKEKGTSRNVKEAQDPEDEIAVLAFLVEAGTQVNEGFQPLVEALSNIPKPEMSTTMAESSLLDLLPKEEKLRHYFRYLGSLTTPTCDEKVVWTVFREPIQLHREQILAFSQKLYYDKEQTVSMKDNVRPLQQLGQRTVIKS

• Full Name: carbonic anhydrase IV
• Calculated Molecular Weight: 35 kDa
• Observed Molecular Weight: 35 kDa
• GenBank Accession Number: BC057792
• Gene Symbol: CA4
• Gene ID (NCBI): 762
• RRID: AB_2877990
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P22748
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

CA4(Carbonic anhydrase 4) is a glycosylphosphatidyl-inositol-anchored membrane isozyme expressing on the luminal surfaces of pulmonary, chorionic (and certain other) capillaries and of proximal renal tubules. It plays a critical role by maintaining the pH in the outer retina, which is important for the normal function of photoreceptors. This protein belongs to the alpha-carbonic anhydrase family.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	IHC	Theranostics; Single-cell analyses reveal evolution mimicry during the specification of breast cancer subtype; Authors - Zhi-Jie Gao
	WB	Sci Rep; Carbonic anhydrase IV in lizard chemical signals; Authors - Marco Mangiacotti
human	WB	J Cancer; Down-regulated C4orf19 confers poor prognosis in colon adenocarcinoma identified by gene co-expression network.; Authors - Wanpeng Wang
human	IHC	Nat Commun; A CCL2+DPP4+ subset of mesenchymal stem cells expedites aberrant formation of creeping fat in humans; Authors - Fengfei Wu
human	IF	Am J Respir Cell Mol Biol; Activated Clec4nhi Neutrophils Aggravate Lung Injury in an Endothelial IGFBP7 Dependent Manner; Authors - Linchao Yu