Tested Applications
| Positive IF/ICC detected in | HeLa cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Immunofluorescence (IF)/ICC | IF/ICC : 1:200-1:800 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
22241-1-AP targets CA5A in IF/ICC, ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag17689 Product name: Recombinant human CA5A protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 77-126 aa of BC137411 Sequence: DPQLKPLRVSYEAASCLYIWNTGYLFQVEFDDATEASGISGGPLENHYRL Predict reactive species |
| Full Name | carbonic anhydrase VA, mitochondrial |
| Calculated Molecular Weight | 305 aa, 35 kDa |
| GenBank Accession Number | BC137411 |
| Gene Symbol | CA5A |
| Gene ID (NCBI) | 763 |
| RRID | AB_3742068 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P35218 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Carbonic anhydrase VA (CA-VA) is a mitochondrial enzyme that is highly expressed in the liver and functions to provide bicarbonate as a substrate for other enzymatic reactions.CA-VA deficiency , which is caused by biallelic pathogenic variants in the CA5A gene, is characterized by neonatal metabolic hyperammonemic encephalopathy, lactic acidosis, hypoglycemia, and ketonuria. (PMID: 41113665, PMID: 24530203)
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for CA5A antibody 22241-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
