CA5B Polyclonal antibody

• Home
• Products
• Primary Antibodies
• CA5B Polyclonal antibody (13342-1-AP)

CA5B Polyclonal Antibody for WB, IHC, ELISA

Cat No. 13342-1-AP Copied!

Publications (1)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, ELISA

Synonyms

CA VB, Carbonic Anhydrase 5B, Carbonic Anhydrase 5B/CA5B, CAVB, CA-VB

• 

  WB analysis of mouse testis using 13342-1-AP

  mouse testis tissue were subjected to SDS PAGE followed by western blot with 13342-1-AP (CA5B antibody) at dilution of 1:4000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of mouse testis using 13342-1-AP

  mouse testis tissue were subjected to SDS PAGE followed by western blot with 13342-1-AP (CA5B antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human kidney using 13342-1-AP

  Immunohistochemical analysis of paraffin-embedded human kidney tissue slide using 13342-1-AP (CA5B antibody) at dilution of 1:600 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human kidney using 13342-1-AP

  Immunohistochemical analysis of paraffin-embedded human kidney tissue slide using 13342-1-AP (CA5B antibody) at dilution of 1:600 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for CA5B in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: mouse testis tissue
• Positive IHC detected in: human kidney tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:6000
• Immunohistochemistry (IHC): IHC : 1:300-1:1200

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

13342-1-AP targets CA5B in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag4166

  Product name: Recombinant human CA5B protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-317 aa of BC028142

  Sequence: MVVMNSLRVILQASPGKLLWRKFQIPRFMPARPCSLYTCTYKTRNRALHPLWESVDLVPGGDRQSPINIRWRDSVYDPGLKPLTISYDPATCLHVWNNGYSFLVEFEDSTDKSVIKGGPLEHNYRLKQFHFHWGAIDAWGSEHTVDSKCFPAELHLVHWNAVRFENFEDAALEENGLAVIGVFLKLGKHHKELQKLVDTLPSIKHKDALVEFGSFDPSCLMPTCPDYWTYSGSLTTPPLSESVTWIIKKQPVEVDHDQLEQFRTLLFTSEGEKEKRMVDNFRPLQPLMNRTVRSSFRHDYVLNVQAKPKPATSQATP

• Full Name: carbonic anhydrase VB, mitochondrial
• Calculated Molecular Weight: 317 aa, 36 kDa
• Observed Molecular Weight: 32 kDa
• GenBank Accession Number: BC028142
• Gene Symbol: CA5B
• Gene ID (NCBI): 11238
• RRID: AB_2243612
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9Y2D0
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

CA5B(Carbonic anhydrase 5B, mitochondrial) is also named as CA-VB and belongs to the alpha-carbonic anhydrase family.CA5B encodes a 317-amino acid protein that has 64% sequence similarity with CA5 (114761), a mitochondrial CA, and contains a 33-amino-acid residue signal sequence. Western blot analysis revealed a 36-kD protein precursor and a 32-kD mature protein(PMID:10409679).

Publications

What published studies show

The CA5B Polyclonal antibody (Cat# 13342-1-AP) has 1 total citation. It was cited in a study published in Journal of Biological Chemistry (IF 4.1) in April 2021, which investigated non-redundant roles of DIAPHs in primary ciliogenesis. The research field is cell biology, specifically ciliogenesis and cytoskeletal dynamics in human cells. The antibody was used for Western blot analysis in this publication.

Automatically generated from the 1 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	J Biol Chem; Non-redundant roles of DIAPHs in primary ciliogenesis.; Authors - Oliva Palander